(data stored in ACNUC7421 zone)

EMBL: CP000667.PE161

CP000667.PE161       Location/Qualifiers
FT   CDS_pept        175631..175840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0161"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52646"
FT                   /db_xref="GOA:A4X196"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X196"
FT                   /protein_id="ABP52646.1"
FT                   /translation="MASRTHEPEPLLTPAEVASMFRVDPKTVTRWAKAGKLSAIRTLGG
FT                   HRRYRESEVRALLQGQIPQQRQGD"
     atggcatcgc gaacgcacga accggagccg ctgctcacgc cggccgaggt ggcgtcgatg        60
     ttccgtgtcg acccgaaaac ggtgacccgt tgggccaagg ccggaaagct gagtgcgatc       120
     cggaccctcg gcgggcaccg cagataccgg gaatcggagg tcagagcgct gttgcagggg       180
     cagatccccc agcagcgcca gggggactga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page