(data stored in ACNUC7421 zone)

EMBL: CP000667.PE169

CP000667.PE169       Location/Qualifiers
FT   CDS_pept        182587..183477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52654"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A4"
FT                   /protein_id="ABP52654.1"
FT                   /translation="MGPEFAPGVKGVKALTDESGKANFSGIYNQETPCAYYANLRRLKY
FT                   EIPQHGATVFNQLIDAQPWGDGYRPTVLDVCCSYGIVGVLTKTDLELDDVYTYYQGAGD
FT                   DGRTVDQVRRAENEFLGQRARPAAPHVIGLDVAENAARHGVAVGALDDAFVENLEATTP
FT                   SSELAKKMSEVDLITTTGGIGYVTERTFERLLTCTEAPPWVAAFCLRTYDYEPISEVLA
FT                   QYGLVTEKADQAVRQRRFIDDTEREWAMAELAARGVDPADMESEGYLYADFYLSRPQED
FT                   ATGKPLADLVTIPAN"
     ttgggccctg agtttgcacc cggagtaaag ggagtcaaag cgttgaccga cgagtccggt        60
     aaggccaact tcagcggaat ctacaaccag gagacgccgt gcgcgtacta cgctaacctg       120
     cgacggttga aatacgagat cccgcagcat ggggctaccg tgttcaacca gttgatcgat       180
     gcccaaccat ggggtgatgg ctatcgcccc actgtgctcg atgtgtgctg ttcctatggc       240
     atcgtcgggg tgctcaccaa gaccgatctt gagctggacg acgtgtacac gtactaccag       300
     ggtgccggtg acgacgggcg taccgtggac caggtgcgcc gcgccgagaa cgaatttctg       360
     ggtcagcgtg cccggccggc cgctcctcat gtcatcgggt tggacgtcgc cgagaacgct       420
     gctcggcatg gtgtggcagt cggcgcgctc gacgatgcat ttgtcgagaa cctggaggcg       480
     acaacgccat cgtcggaatt ggctaagaag atgtcagagg tcgacctcat cacgaccacg       540
     ggtggcattg gctatgtcac tgagcggacg ttcgagcggc tacttacctg cactgaagcc       600
     ccgccctggg tcgccgcgtt ctgccttcgg acgtacgact atgagccgat ttcggaggtg       660
     ctcgcgcagt acgggctcgt gaccgagaag gcggaccagg ctgttcggca gcggcggttt       720
     atcgacgaca ccgaacgaga gtgggcaatg gcggagctgg cggcgcgggg ggtcgacccg       780
     gccgacatgg agagtgaggg atatctgtac gccgatttct acctctcccg gccgcaggaa       840
     gacgcaacag ggaagccgct ggcagacctg gtgacgattc cggccaacta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page