(data stored in ACNUC7421 zone)

EMBL: CP000667.PE17

CP000667.PE17        Location/Qualifiers
FT   CDS_pept        complement(20241..24707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0017"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; E1-E2 ATPase-associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52502"
FT                   /db_xref="GOA:A4X0V2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V2"
FT                   /protein_id="ABP52502.1"
FT                   /translation="MIPLGRVAGSVRAPAVPELMGQAARNLGSAAARAARLTGLTRRRV
FT                   WSRYGRHHIEVHGVCQDGGERLARQVEAALERVPGVNWARVNAPSGRVVVAVGSPEPRL
FT                   RDLIVTVARAERISPHEPDPEIPPPHPPEEGPRTPRTLGALASDALGLTISAATRILPF
FT                   TPVPGEVAGLLNAVDLHPRLHALADRGVRADPRADLLFPLAEAVAQGLAGGWTGIVLDG
FT                   IQRVVQWGEARAQLAAWTTAEPRLAGAPGRAAAPVLPTERPCPKPDGPAEKYVIQMLHA
FT                   GAAAAAAATPVAGAKRAAALGLSALPKASGSGREGYAAQLGSLLARRGVVAMDRRALRE
FT                   LDRIDTLVLDATILGSNRGLLTDLAPLGDAELGEVAARAFALFDPDQPAAVQHSAGWGL
FT                   GPLDLLDAPDPGDTSHSDRLRASGGRLLGLAHDGRLVALLRVETEPAPGVDLLPAAARR
FT                   AGLRLVVTDDDPGRYDFADTVLAGGARLPETVRQLQRDGAVVMLLSDDRRALAAADCGL
FT                   GVTTDEELPPWGAHLLVGTDLQVSALVVEAAGVARRMTTQNIRLGLGGAGLGALAALTA
FT                   AREQLPERALASVNGTAALAFAHGVWRAHHLPNPMETPAERTAVPWHLMPVGTVLDELG
FT                   SGFDGLDPVDAGRRRSSRIADGVPTPTLLRAFLDELANPLTPVLAAGAVLSASFGSLVD
FT                   AALVSGVVGGSALVGAVHQRNTERSLAELLSRTAVTARVRRGGTEQQLPAHDLVPGDVI
FT                   ILEAGDAVPADCRVLEATGLEADESSLTGESLPVGKTDQPVAATDIAERRSMLYEGTTV
FT                   AAGHGRGVVVATGTDTEAGRSLSLARQTRPSGGVEARLGGLTDSAIPLALGSAVAVAGA
FT                   GVARGIPLAETASTAANLAVASVPEGLPFLVSAAQLAAARRLAERGALVRNPRTIEALG
FT                   RVDVLCFDKTGTLTEGRLVLSGVGDGARFAAVDQLDEHLRMVLAVALRAAPDADDPEQL
FT                   PEQADRAIRRAARETNTVEQTGAGDWRPAGGLPFEPSRGYHATVGTCGDRLVLSVKGAP
FT                   ETVLPRCRNRRTEAGVVPLDDATRKAVQQELLRHAGAGQRVLALAERVVVEESIADDDV
FT                   QGLTFVGILALADGIRASAAPAVESIRKAGVHTIMITGDHPATAEAIASVISPGDGQRV
FT                   ATANDLADLDDEALAARLVTTDVVARCTPAHKVRIIQALRTCGRTVAMTGDGANDAPAI
FT                   RLADVGIALGQRGTPAARAAADLVVMDDRLETIIATLAEGRAMWSSVRHALSILFGGNL
FT                   GEIAFSIVTAAVDGRSALNGRQLLLVNLLTDLAPALAVAVRPPPPEYSENLLREGPDTS
FT                   LGATLNRELGVRATSTALGATAGWVLSKWVAASPRRAGTVALVSLIGTQLGQTLMAGGT
FT                   TPGVLLSTAGSVGVLVLVVQTPGLSHFFGCTPLGPICWTIATGSAAGAALANGTVARLV
FT                   EQLPAPPRPGVDLHDLLNRLRHWGHGS"
     atgatcccgc tgggccgcgt cgctggcagc gtacgcgcgc ctgccgtgcc agagctgatg        60
     gggcaggcgg cccggaacct cggatccgcc gctgcccgag ccgcgcggct caccggtctg       120
     acccgccgcc gggtctggtc ccgctacggc cgacaccaca tcgaggtgca cggtgtctgt       180
     caggacggcg gggagcggct cgcccggcag gtcgaagcgg cgctggaacg cgtccccggc       240
     gtgaactggg cgcgggtgaa cgccccctcc gggcgggtgg tggtcgccgt cggctccccc       300
     gagccgaggc tgcgcgatct gatcgtcacc gtggcccgcg ccgaacgcat cagcccgcac       360
     gaaccggatc ccgagatccc accgccgcat ccgccggagg aaggaccccg caccccccgt       420
     acgctcggcg ccctcgcctc cgatgcgctc ggtctgacga tttccgccgc cacccggatc       480
     ctgcccttca ccccggtgcc tggtgaggtc gccggcctcc tcaacgcggt cgacctgcac       540
     ccgaggctgc acgccctcgc cgaccgggga gtgcgcgccg acccccgcgc cgacctcctc       600
     ttcccgctgg ccgaggcggt ggcgcagggc cttgcgggcg gctggaccgg aatcgtcctc       660
     gacggcatcc agcgggtggt gcagtggggc gaggcgcggg cccaactcgc cgcgtggaca       720
     acggccgagc cccgactcgc cggcgccccg ggccgggccg cggcccccgt cctgccgacc       780
     gaacggccct gcccgaaacc ggatggaccg gccgagaagt acgtcatcca gatgctccac       840
     gccggcgcgg cagcagccgc cgccgcgacc ccggtggccg gtgcgaagcg agccgccgcg       900
     ctcggcctct ccgcgctccc gaaggccagc ggctccggcc gcgaggggta tgccgcccag       960
     ctcggtagcc tgctcgcacg acgcggcgtc gtcgccatgg accgccgcgc actccgcgaa      1020
     ctcgaccgga tcgacacgct ggtgctggac gccacgatcc tcggctccaa ccgcggcctc      1080
     ctcaccgacc tggcccccct gggcgacgcg gagctgggtg aggtggccgc ccgagcgttt      1140
     gccttgttcg acccggatca gccggcggcg gtccagcaca gcgctggctg gggcctcggc      1200
     ccgctggacc tcctcgacgc acctgacccg ggcgacacct cacacagtga ccggcttcgc      1260
     gcatccggcg gccggctcct cggcctggca cacgacggtc ggctcgtcgc gctgctgcgg      1320
     gtcgagaccg agccggcccc gggcgtggac ctcctgccgg ccgctgcccg gcgcgccggg      1380
     ttgcggctgg tcgtgacgga cgacgacccg ggccggtacg acttcgcgga caccgtcctc      1440
     gccggcggtg cccggctccc cgagaccgtg cgccagctgc aacgcgacgg cgcggtcgtg      1500
     atgctgctct ccgatgaccg gcgggcgctc gcggcagccg actgtggcct cggcgtgacc      1560
     accgacgagg agctgccgcc ctggggggca cacctgctcg tcggcaccga cctccaggtg      1620
     tcagcactgg tggtcgaggc ggctggggtg gcccgccgga tgacgaccca gaacattcgg      1680
     cttgggctcg ggggcgccgg tctcggggcg ctggctgcac tcaccgctgc ccgggaacag      1740
     ctcccggaac gggccttggc ctcggtcaac gggacggcgg cactggcctt cgcccacggc      1800
     gtgtggcggg cccaccacct gcccaacccc atggagaccc ccgccgaacg gacggcggtc      1860
     ccgtggcacc tgatgccggt ggggaccgtc ctcgacgagt tgggcagtgg cttcgacggg      1920
     ttggatccgg tggacgccgg ccgccgacgc tccagccgga tcgccgacgg cgttcccacc      1980
     ccgaccctgc tccgcgcctt cctggacgag ctagccaacc cgttgacccc ggtcctggcc      2040
     gccggggcgg tgctatccgc gtcgttcggc tcgctggttg acgccgccct ggtcagcggg      2100
     gtggtaggcg gctccgccct ggtcggcgcg gtgcaccaac gcaacaccga gcggtcgctg      2160
     gccgagttgc tgtcccgtac cgcggtcacc gcccgggtcc ggcggggcgg caccgagcag      2220
     cagctacccg cccacgacct ggtccccgga gatgtgatca tcctggaagc aggtgacgcc      2280
     gtaccagccg actgccgggt cctcgaggcc acggggctgg aagcagacga gtcctcgctc      2340
     accggcgagt cgttgccggt cggcaagacc gaccaaccgg tggccgcgac cgacatcgcc      2400
     gagcgccgtt cgatgctgta cgagggcacc accgtcgccg ccggtcacgg ccggggcgtg      2460
     gtcgtcgcca ccggtaccga cacggaagca gggcgcagcc tcagcctcgc tcggcaaacc      2520
     cggcccagcg gcggcgtcga agcgcgactc ggcggactca ccgactcggc gataccgctc      2580
     gcgctcggat ccgccgtcgc ggtcgccggg gccggcgtcg ctcgcggcat accgctggcc      2640
     gagaccgcct cgaccgccgc gaacctggcc gtcgcgtcgg tgcccgaggg gttgccgttc      2700
     ctcgtcagcg ccgcgcagct ggcagcggcc cggcggctcg ccgaacgcgg tgccctggtg      2760
     cgtaaccccc gcacgatcga ggcgttgggg cgcgtcgacg tgctctgctt cgacaagacc      2820
     ggaaccctga ccgaggggcg gctggtgctc tccggagtcg gcgacggtgc gcggttcgcc      2880
     gccgttgacc agctcgacga gcacctccgc atggtcctcg cggtcgcgct gcgtgccgct      2940
     ccagacgccg acgacccgga acagcttccc gagcaggccg accgggcgat ccgccgggcg      3000
     gcccgggaga ccaacacggt ggagcagacc ggcgccggag attggcgtcc cgccggaggg      3060
     cttcccttcg agccgtcccg cggctaccac gccaccgtcg gcacctgcgg cgaccgcctg      3120
     gtcctcagcg tcaagggcgc cccggagacc gtcctgcccc gctgccggaa ccggcggacc      3180
     gaggccgggg tggtgccgtt ggacgacgcg actcggaagg cggtccagca ggaattgctc      3240
     cggcacgccg gggccggcca gcgggtgctg gccctcgccg aacgggtcgt cgtcgaggag      3300
     tccatcgccg acgacgatgt ccagggcctg accttcgtcg gcatcctcgc gctggccgac      3360
     gggatccggg caagcgccgc cccggcggtg gagagcatcc gcaaggcggg ggtgcacaca      3420
     attatgatca ccggcgacca tccggccacc gccgaggcga tcgcctcggt gatcagcccc      3480
     ggcgacggcc agcgggtggc gaccgccaac gacctcgcgg acctcgacga cgaggcgctg      3540
     gcagcccgcc tggtcaccac cgacgtcgtg gcccggtgca ctccagccca caaggtacgg      3600
     ataatccagg cgctccggac ttgtggtcgc accgtggcga tgaccggcga cggcgccaac      3660
     gacgcacccg ccatccgcct cgccgatgtc ggcatcgccc tcggacagcg cggcaccccc      3720
     gcggctcgcg cggcggcaga cctggtggtc atggacgacc gactggagac catcatcgcc      3780
     accctcgccg aaggacgggc gatgtggtcg tcggtccggc acgcgctgag catcctgttc      3840
     ggcggcaacc tcggcgagat cgcgttcagc atcgtcaccg ccgccgtcga cggccgctcc      3900
     gcgctcaacg gccgacaact gctgctcgtc aacctgctca ccgatctggc ccccgcgctg      3960
     gccgtggcgg tccggccgcc cccaccggag tacagcgaga acctgctccg ggaagggcct      4020
     gacacctccc tcggcgccac cctcaaccgg gaactcggcg tccgcgccac ctccaccgcg      4080
     ctcggcgcca ccgccggctg ggtgctgtcc aagtgggtgg cggcgtcacc acgccgggcc      4140
     ggcacggtag ccctggtgtc gctgatcggc acccagctcg gccagaccct gatggccggc      4200
     ggcaccaccc ccggcgtcct gctctccacc gccggctcgg tgggggtgct cgtactggtc      4260
     gtacagactc ccgggctcag ccacttcttc ggctgtaccc cgctcggccc gatctgctgg      4320
     acgatcgcca ccggctccgc ggccggcgcc gccctcgcca acggcacggt cgcccgcctg      4380
     gtggagcagc taccagcgcc gccccgcccc ggggtggacc tgcacgacct cctcaaccgc      4440
     ctacgccact gggggcacgg cagctag                                          4467
//

If you have problems or comments...

PBIL Back to PBIL home page