(data stored in ACNUC7421 zone)

EMBL: CP000667.PE177

CP000667.PE177       Location/Qualifiers
FT   CDS_pept        192982..196680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0177"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52662"
FT                   /db_xref="GOA:A4X1B2"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B2"
FT                   /protein_id="ABP52662.1"
FT                   /translation="MSAHRPPEVHDPATDQVPGAAPLLAARRFLRRELVGDHGRTLHQI
FT                   ADGDWDRFYRDQWRYDRVVRSTHGVNCTGSCSWNVFVKDGLITWEHQATDYPTTGPDSP
FT                   DYEPRGCPRGASFSWYEYSPSRVRHPYVRGVLAEMFRDGLARLGDPVSAWADIVENPLK
FT                   ARAYKTQRGRGGFVRASWDEVTTMVAAAHVYTTKTYGPDRVVGFSPIPAMSMASFAAGT
FT                   RYHALLGGTLLSFYDWYADLPIASPQIWGDQTDVPEAGDWWNATYLMMWGSNIPVTRTP
FT                   DAHFLAEARYRGTKVVAVSPDYADNVKFADDWLAPHPGTDGALAMAMGHVVLTEFFRDR
FT                   TVDYFTDYVRRFTDLPFLVTLRPTAGGRWATDRFLTAADLGQEDGAHKTVLVDEHTGEL
FT                   VVPNGSLGFRYGEAGQGRWNLDLGEVFPALGLLDRSDEAIEVELARFDVGETEGGSTIS
FT                   RGVPVMRVGEQLVTSVYDLVLAQYGVRRGDLPGQWPTGYDDPESPNTPAWQERITGVPA
FT                   AVATRIGREFARNAERSQGRSLIVLGAGANQWFHSDMTYRALISLVTLTGCQGVNGGGW
FT                   AHYVGQEKARPITGQQHMSFGLDWQRPMRHQASTPFWYLHTDQWRYERVPVDELSSPLG
FT                   TGRFAGMAFADTVAAAQRMGWSPGHPSFNRNPLDLTDEAAAAGVTVQEHIVAELKAGRL
FT                   RSVAEDPDDPANFPRCLTLWRANLLGSSGKGNEYFLRHLLGIDSTATASECDPEHRPRD
FT                   LVWRDEAPTGKLDLLTAIDFRMTNTGLHADVVLPTATWYEKHDISTTDMHPFVHAFSPA
FT                   VEPPADAHSDYDTFLALADRFSELAAGHLGVRRDVLAAPLQHDTPDELAMPSGRVRDWK
FT                   AGECEPIPGATMPKLIEIERDYSQIGAKMRAVGPLLDRLGTSTKALTVDVTVELAYLRE
FT                   RNGVVPDGPFAGRPSLATADRMCEAILALSGTTNGRVAAAGFAALEKRTGQPFADLIAG
FT                   HENDQITYADTQRAPQSVFTSPEWSGSEKGGRRYSPFTLNVERLKPWHTITGRQHFFVE
FT                   HDWVAELGEQLPGFRPPLNMARHFGAPGELVDGGVTVRFLTPHAKWTIHSMYHDNELML
FT                   ALSRGGPVIWMSVPDAAKVGVRDNDWVEAHNRNGVIVARAVVSHRMPEGTVFQYHSPER
FT                   TINVPKAEKSGRRGGYHNSLTRLLVKPTHLAGGHAQLTYAFNYYGPIGSQRDEITVIRR
FT                   RDQEVEY"
     gtgtcagcgc accgcccgcc agaagttcat gatcctgcga cggaccaggt acccggtgcg        60
     gcgccgttgc tggctgctcg gcgcttcctc cgccgggagc tggtcggtga ccacggccgg       120
     acactgcacc agatagctga cggtgactgg gaccggttct accgcgacca gtggcgttac       180
     gaccgggtgg tgcgctccac ccacggcgtc aactgcaccg gctcgtgctc gtggaacgtc       240
     tttgtcaaag acggcctgat cacctgggaa caccaggcca ccgactaccc cacgaccggc       300
     ccggactcgc cggactacga gccgcgtggc tgtccccgcg gtgcctcctt ctcctggtac       360
     gagtactcgc cctcccgggt gcgccacccc tacgtacggg gggtgctggc cgagatgttc       420
     cgcgacgggc tcgcgcgcct gggcgatccg gtgtccgcct gggccgacat agtggagaac       480
     ccactcaagg cgcgcgccta caagacccag cggggacgtg gcggctttgt gcgcgccagt       540
     tgggacgagg tgaccacgat ggtcgccgcc gcgcacgtgt acaccacgaa gacgtacggg       600
     ccggaccggg tggtgggctt ctcgccgatt ccggcgatgt cgatggcgtc cttcgccgcc       660
     ggcacccgtt accacgccct gctcggtggc accctgctga gcttctacga ctggtacgcc       720
     gacctgccga tcgcctcgcc gcagatctgg ggtgaccaga ccgacgtgcc cgaggccggc       780
     gactggtgga acgccaccta tctgatgatg tggggctcga acattccggt cacccgtact       840
     ccggacgccc acttcctggc cgaggcccgc taccggggca cgaaggtcgt cgcggtcagc       900
     ccggactacg ccgacaacgt caagttcgcc gacgactggc ttgccccgca cccgggtacc       960
     gacggtgcgc tggcgatggc gatgggccac gtcgtgctca ccgagttctt ccgggaccgc      1020
     acggttgact acttcaccga ctacgttcgc cgcttcaccg acctgccgtt cctggtcacg      1080
     ctgcgaccga ccgcaggtgg ccggtgggct acggaccgtt tcctcaccgc agcagacctg      1140
     ggccaggagg acggagcgca caagaccgtc ctggttgacg agcacaccgg cgaactggtc      1200
     gtgccgaacg ggtcgctggg cttccggtac ggcgaggccg gccaggggcg ctggaacctc      1260
     gacctgggcg aggtgttccc cgctcttggg ctgctcgacc ggagcgacga ggcgatcgag      1320
     gtcgagctgg ctcgcttcga cgtcggagag accgagggtg ggtccaccat cagccgcggc      1380
     gtgccggtca tgagggtcgg cgagcagctg gtcacctcgg tctacgacct ggtgctggcg      1440
     cagtacgggg tgcgccgcgg cgacctgccg gggcagtggc cgaccggcta tgacgacccg      1500
     gaatccccga acacgccggc ctggcaggag cggatcaccg gggtaccggc cgcggtggcc      1560
     acccggatcg gccgggagtt cgcccgcaac gccgagcgca gccaggggcg gtcgttgatc      1620
     gtcctgggcg ccggcgcgaa ccagtggttc cactccgaca tgacctaccg ggcgctcatc      1680
     tccctggtca ccctgaccgg ctgccagggt gtcaacggcg gcggctgggc gcactacgtc      1740
     gggcaggaga aggcccgccc gatcaccggc cagcagcaca tgtccttcgg gctcgactgg      1800
     caacggccga tgcgacacca ggcgagtacg ccgttctggt acctgcacac cgaccagtgg      1860
     cggtacgagc gggtcccggt cgacgagttg tcctccccgt tgggcaccgg ccggttcgcc      1920
     gggatggcct tcgccgacac cgtcgccgcc gcgcagcgga tgggctggag ccccggccac      1980
     ccgtcgttca accgcaaccc gctcgacctc accgacgagg cggcggcggc cggggtgacg      2040
     gtgcaggagc acatcgtcgc cgagctgaag gccggccggc tacggtcggt ggcggaggac      2100
     ccggacgatc cggcgaactt cccgcgctgc ctcacgctgt ggcgggcgaa cctgctcggc      2160
     tcctccggca agggcaacga gtacttcctg cgccatctgc tggggatcga ctcgaccgcc      2220
     accgcctcgg agtgcgaccc ggagcaccga ccccgggacc tcgtgtggcg agatgaggcg      2280
     ccgacaggga agcttgacct gctcacggcg atcgacttcc ggatgaccaa caccggtctg      2340
     cacgccgacg tggtgctgcc caccgcaacc tggtacgaga agcacgacat ctccaccacg      2400
     gacatgcacc cgttcgtgca cgcgttcagc ccggcggtgg agccgcccgc cgacgcccac      2460
     tccgattacg acaccttcct ggcgctcgcc gaccggttca gtgagctggc cgccggccac      2520
     ctgggcgtgc ggcgggacgt gctggccgcg ccgctgcaac acgacacacc agacgagttg      2580
     gccatgccca gcgggcgggt gcgggactgg aaggctggcg agtgcgagcc gatccccggc      2640
     gccaccatgc cgaagctcat cgagatcgag cgggactact cccagatcgg cgcgaagatg      2700
     cgtgccgttg gcccgctact cgaccggctc ggcaccagca cgaaggcgct caccgtggac      2760
     gtgaccgtgg agctggcgta cctgcgggag cggaacgggg tcgtccctga cgggccgttc      2820
     gccggccggc cgtcgctggc caccgccgat cggatgtgcg aggcgatcct ggcgctgtcg      2880
     ggcaccacga acggtcgggt tgccgcggcc ggtttcgcgg cactggagaa gcggaccggt      2940
     caaccgttcg cggatctgat cgccggccac gagaacgacc agatcacgta cgcggacacc      3000
     cagcgggcgc cgcagtcggt cttcaccagc ccggagtggt ccggctcgga gaagggaggc      3060
     cgtcgctact cacccttcac cctcaatgtg gagcggctca agccgtggca caccatcacc      3120
     ggccggcagc acttcttcgt ggagcacgac tgggtggcgg agttgggcga gcagttgccg      3180
     ggcttccgac ccccgctgaa catggcccgg cacttcggcg cgcccggtga gttggtcgat      3240
     ggcggcgtca ccgtacgttt cctgacccca cacgcgaagt ggacgatcca ctcgatgtac      3300
     cacgacaacg aactgatgtt ggcgttgtcg cgaggtgggc cggtgatctg gatgagcgtg      3360
     cccgacgccg cgaaggtcgg cgtacgggac aacgactggg tggaggcgca caaccgcaac      3420
     ggagtcatcg tggcccgagc ggtggtcagt caccggatgc cggagggcac ggtgttccag      3480
     taccactcgc cggagcggac gatcaacgtg cccaaggcgg agaagagcgg tcgccggggc      3540
     ggctaccaca actcgttgac ccggctgctg gtcaagccca cccatctggc cggcggacac      3600
     gcccaactca cctacgcctt caactactac ggcccgatcg gcagccaacg cgacgagatc      3660
     acggtgatcc gccgccgcga ccaggaggtg gagtactga                             3699
//

If you have problems or comments...

PBIL Back to PBIL home page