(data stored in ACNUC7421 zone)

EMBL: CP000667.PE18

CP000667.PE18        Location/Qualifiers
FT   CDS_pept        24882..25184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52503"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V3"
FT                   /protein_id="ABP52503.1"
FT                   /translation="MENHGGHRRFWEVEMSMLTRDLSGSRDMIRTFTHRVEVPVLGEMA
FT                   IPPPDKLAYYAGVGLLTLLQVIEWPVALVVTAGHVLADQHLSGLAKGLGEALETA"
     gtggaaaacc acggcggtca ccgccgtttc tgggaggtcg agatgagcat gttgacccgg        60
     gatctcagtg ggagtcggga catgatccgg acgttcaccc accgagtgga ggtaccggta       120
     ctgggggaga tggccatccc gccgccggac aaactggcgt actacgcggg cgtgggtctg       180
     ctcaccctgt tgcaggtcat cgagtggccg gtggcgttgg tggtgaccgc tggtcacgtg       240
     ctcgccgacc agcatctgtc tgggctggcc aagggactcg gggaggcgtt ggagaccgcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page