(data stored in ACNUC7421 zone)

EMBL: CP000667.PE180

CP000667.PE180       Location/Qualifiers
FT   CDS_pept        198964..199707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0180"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52665"
FT                   /db_xref="GOA:A4X1B5"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B5"
FT                   /protein_id="ABP52665.1"
FT                   /translation="MTNLVWIVLPYLCLAVFVAGHVWRWRHDQFGWTTHTSQVLENRIL
FT                   RLGSPLFHLGALGVVAGHAMGLVVPASVTEKLGLSEHAYHLIAVWGGTVTGLMLTVGLV
FT                   LLIIRRMVNGRVRRVTTRMDKVLYAALAGMVALGMVATVGVNLLGGGYDYRETIAVWFR
FT                   GIFWFQPDPALMSGAPLVYQLHAIGGFLFLALWPFTRLVHVWSAPLAYLWRPYVVYRAR
FT                   RGPAPSPTASPNQVRDAAREPSARR"
     atgaccaacc tcgtctggat cgtcctgccg tacctgtgtc tcgcggtctt cgtcgccggc        60
     cacgtctggc ggtggcgcca cgaccagttc ggctggacca cgcacaccag ccaggtgctg       120
     gagaaccgca ttctgcggct cggttcgccc ctgttccacc tcggtgctct cggcgtcgtt       180
     gcggggcacg ccatgggtct ggtggtgccc gcgtcggtga ccgagaagct cggtctgagc       240
     gaacacgcct accacctcat cgcggtctgg ggcggcacgg tgaccggcct gatgctgacg       300
     gtcggcctgg tattgctgat catccgtcgt atggtcaacg gccgggtccg tcgggtcacc       360
     acccggatgg acaaggtgct ctacgccgcg ctcgccggca tggtggcact cggcatggtc       420
     gccacggtgg gggtcaacct gctcggtggg ggctacgact accgggagac gatcgccgtc       480
     tggttccgcg ggatcttctg gttccagcct gaccccgcgc tgatgagcgg ggctcccctg       540
     gtctaccagc tgcacgcgat cggtggcttc ctcttcctgg cgctgtggcc gttcacccga       600
     ctggtgcacg tctggtcggc cccactggcg tacctgtggc gtccgtacgt cgtctaccgc       660
     gctcgccgcg gcccagcgcc gtcgccaacg gcgtcgccga atcaggtacg ggatgctgcc       720
     cgggagccgt cagcccggcg gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page