(data stored in ACNUC7421 zone)

EMBL: CP000667.PE19

CP000667.PE19        Location/Qualifiers
FT   CDS_pept        25315..25509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52504"
FT                   /db_xref="GOA:A4X0V4"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V4"
FT                   /protein_id="ABP52504.1"
FT                   /translation="MFTLVTTVILYVGGFVFLYGVIRLAIRHALEEAEVRRVQAQRAEE
FT                   LAAHRDRTLLEGKGYLTGG"
     atgttcaccc tggtcaccac cgtgattctg tacgtcggag gtttcgtctt cctgtacgga        60
     gtgatccgcc tcgcgatccg gcacgccctg gaggaggcgg aggtacgtcg ggtccaggcc       120
     cagcgggccg aggagttggc cgcccatcgt gatcggaccc tgctggaggg gaagggctat       180
     ctcaccgggg gctga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page