(data stored in ACNUC7421 zone)

EMBL: CP000667.PE190

CP000667.PE190       Location/Qualifiers
FT   CDS_pept        219236..221071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52675"
FT                   /db_xref="GOA:A4X1C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C5"
FT                   /protein_id="ABP52675.1"
FT                   /translation="MPAEPKAFARRFRLDRVGAVAVALIVVSVAWRAGLAARGWFSQDE
FT                   FVLAAQALDARLDADFLLQTVNDSLMPGGLLTAWLMVRLAGFASWPWVLMLAVGQAAVG
FT                   VAVYRLLRDLLRPGWGLLVPLALFLFSPLTLEVSSLWLVGLLVLPMQLALVLAVRAQVR
FT                   YVRTGRLGHLATVALWLLFGLLFDPKALLIAPLLFLLTVFLFSDGSPWRSLVTVVRRHW
FT                   RGWLLLTLLSGAYLAFYLTRPARALDQLTSPGQAFTFLGDLVGATVVPGLLGGPWRWTY
FT                   AGDGPPLVDPYPVAMWLSWLVLATLVVVTVRRRRSAVRAWLLLACYVGLVAALFAVTHV
FT                   GGVLGPMVGTVPRFVADVVPVAAICVGVALFGLRDDGERARYAARPLPGVPRALGSITV
FT                   GRVVTIAVLVAVGTGAVWSTVRFGENWSTKHGREYLTTAQAELAAAPADTVFLDAVVPD
FT                   RVVAGYFWPDNRQSHFFRPAERRPEFVEVAELPVTFDEEGRIRPVRIEGVTVLPGPVPD
FT                   CGHRVESGQTTQIPLETRVEQWPHVVEFGYLSSGDATATMRLGEATREITVRRGLNQLY
FT                   FPLPGAGETIEVTLSTPDVALCTKLITVGRVVPAS"
     atgcccgccg agccgaaagc gttcgctcgg cggtttcgtc tggaccgggt tggagcggtg        60
     gcggtagccc tcatcgttgt gtcggtcgcc tggcgtgccg gcctcgcggc gcgtggctgg       120
     ttctcccagg acgagtttgt cctcgccgcc caggcccttg atgcccggtt ggacgcggac       180
     ttcctgctgc aaaccgtcaa cgactccctg atgcccggtg gcttgttgac cgcctggctg       240
     atggtgcggc tggccggctt cgccagctgg ccctgggtat tgatgcttgc ggtggggcag       300
     gcggccgtgg gtgtcgcggt ctatcgcctg ctgcgcgatc tgctgcggcc aggctggggc       360
     ctgctggtcc cgttggccct cttcctgttc agcccgctga cgctggaggt gtcgtcgctg       420
     tggttggttg ggctgctcgt gttgccgatg cagctcgccc tggtcctcgc ggtccgggcg       480
     caggtccggt atgtgcgtac cggccgcctc ggccatctcg cgacggtcgc cctgtggctg       540
     ctgttcggcc tgctgttcga cccgaaagcg ctgctgatag cgccgctgtt gttcctgctg       600
     accgtctttc tgttttccga tggctcgccg tggcgcagcc tggtcacggt ggtgcgccgg       660
     cactggcggg gctggctgtt gctcaccctg ctctcggggg cctacctggc gttctacctg       720
     acccgaccgg cacgtgcgct ggaccagctg acctcgcccg gtcaggcttt cacgttcctc       780
     ggtgacctgg tcggcgcgac cgtcgtgcca ggcctgctcg gggggccatg gcggtggacg       840
     tacgccggtg acgggccacc gttggtggat ccctatccgg tcgcgatgtg gctgtcttgg       900
     ctggtgctgg cgacactggt cgtggtcacc gtccgacggc gccggtcggc ggtgcgggcc       960
     tggctcctcc tggcctgtta cgtcgggctg gtcgccgcgc tcttcgcggt gacccacgtc      1020
     ggtggcgtgc tcggcccgat ggtgggtacg gttccgcgct tcgtggccga tgtggtgccg      1080
     gtcgccgcga tctgtgtcgg agtcgccctg ttcgggcttc gcgacgacgg cgaaagggcc      1140
     cggtacgccg cccgaccgct gccgggggtc ccgcgggcgc tcggctccat cacggtcggt      1200
     cgggttgtga cgatcgccgt cctggtcgcg gtcggaactg gcgcggtgtg gagcaccgtt      1260
     cggttcgggg agaactggag caccaagcat ggtcgggagt acctgaccac ggcccaggcc      1320
     gagcttgccg ccgcgccggc ggataccgtc tttctggacg ctgtcgtccc cgatcgggtc      1380
     gtcgccgggt acttctggcc ggacaaccgt caatcgcact tcttccggcc ggcggagcgc      1440
     cggccggagt tcgttgaggt agccgagctt ccggtgacct tcgatgagga gggtcgaatc      1500
     cgtccggtcc ggatcgaggg cgtgacggtt ctgccgggcc cggtgcctga ctgtgggcac      1560
     cgggtggaga gcgggcaaac gacgcagatt ccgttggaaa cgcgtgttga gcagtggccg      1620
     cacgtggtgg agttcggcta cctgagctcc ggtgacgcga ccgcgaccat gcgtctgggc      1680
     gaggccaccc gggagatcac ggtgcggcgt ggactgaacc agctgtattt cccgttgccc      1740
     ggtgcgggag agactatcga ggtcaccctc agcacgcctg atgttgccct ctgtactaag      1800
     ttgatcactg tcgggcgggt ggtgccggcg tcgtga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page