(data stored in ACNUC7421 zone)

EMBL: CP000667.PE191

CP000667.PE191       Location/Qualifiers
FT   CDS_pept        221072..222823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52676"
FT                   /db_xref="GOA:A4X1C6"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C6"
FT                   /protein_id="ABP52676.1"
FT                   /translation="MVDRPADRARVVRDRLLLYTVATAVTAVVLAPLAAPGYVLLYDMV
FT                   FVPRQPLTWDLVAPVQGLPRAVPMDAVVSVLTQLVPGWVVQRIALGGAVLLAAVGAGRL
FT                   VPTERPGVRLLAAVGYAWTPYLAERLLIGQWGLLVGYAALPWLVRAVLELRSGRAGAVA
FT                   RVLLAAAPAAITPTGGLIAFGVVSLLAPQRGRWRGSTVAVAGVALLNAPWVTAALVTDA
FT                   GGSSDPAGVAAFAARGENWAGPLAALAGTGGIWSAQATPASRALPLVPLVTLVLLALAG
FT                   FGFGLLRRRIPRDASARLLVLAGGGFLLAALGAVPGTADVLRWAVAQLPGAGLLRDGQK
FT                   FLAPYALLLVVCVALGAERVAARMERRNREVAGVVLVGVLLLPVAAMPDLAFGGVGRLW
FT                   PVSYPADWRVVAARLAADPGGEVLALPLSGYRAYPWNSGRIVLDPAPRYLPAVVLIDDT
FT                   LRVGDVAVTGENTRLREIRQVLGAGRPVAETGVRWVLVQQHRADQVDPVTLAGLEVVHQ
FT                   GTYLVLYRNPAVPPSPVVVSPARWAVAVALVVAIVVVVAAFLRRYAGGLLRGNLRSEVQ
FT                   TLEDWHA"
     gtggttgacc gaccggccga ccgagcccgg gtggttcgtg atcggctcct gttgtacacc        60
     gtcgcgacgg cggtgacggc ggtggtgctc gctcccctgg cggcaccggg ctacgtgctg       120
     ctctacgaca tggtgttcgt gccccgacag ccgctgacct gggatctcgt ggcgccggtg       180
     cagggcctgc cgcgggcggt gccgatggac gcggtggtct cggtgctcac ccaactcgtc       240
     ccgggctggg tggtgcagcg gatcgcgctg ggtggggcgg ttctgctggc ggcggtcggt       300
     gccgggcggc tggtgccgac cgaacggccc ggggttcggc tgctcgctgc ggtcggctat       360
     gcctggacgc cctacctggc cgagcggctg ttgatcgggc agtggggact gctggtcgga       420
     tacgccgccc tgccgtggct ggtacgggcg gtgttggagc tgcggtccgg gcgggccggc       480
     gcggtggccc gcgtgctgct cgccgccgcg ccggctgcga ttaccccaac cggtgggctg       540
     atcgcgttcg gtgtggtgtc gttgctcgca ccacagcggg ggcgttggcg gggatcgacg       600
     gtcgcggtgg cgggggtcgc cttgctcaac gccccgtggg tgaccgctgc cctggtcacc       660
     gacgcgggcg gaagctccga tccggcggga gtggccgcct tcgcggcccg gggcgagaac       720
     tgggccggtc cgctggctgc gctcgccggc accgggggta tctggagcgc tcaggccact       780
     ccggcgagcc gagccctgcc cctggtgccg ctggtgaccc tggtgctgtt ggccctggcc       840
     ggtttcgggt ttggcctgct gcggcgtcgg ataccgcggg atgcttcggc ccgactgttg       900
     gtgctcgcgg ggggcggctt tctgctcgcc gcgctcggtg cggtgccggg gacggccgac       960
     gtgttgcggt gggcggtggc gcagctgccg ggggccgggc tgcttcgcga cgggcagaag      1020
     ttcctggcac cctacgcgtt gctgttggtg gtgtgcgtgg cgctgggtgc cgagcgggtc      1080
     gccgcccgga tggagcgaag aaaccgggag gttgcggggg tggtgctggt gggcgtgctg      1140
     ctgctgccgg tcgccgccat gccggatctc gcgtttggtg gcgtgggtcg gttgtggccg      1200
     gtgagctatc cagcggactg gcgggtggtg gccgcccgac tggctgccga ccctggcggc      1260
     gaggtcttgg cgctgccgtt gagtggctac cgtgcgtacc cgtggaattc cgggcggatc      1320
     gtcctggatc cggcccctcg ctacctgccg gcggtggtgc tgattgatga cacgctccga      1380
     gtcggcgatg tcgcggtgac tggtgagaac acccgcctgc gggagatccg gcaggtgctc      1440
     ggggcgggac ggccggtcgc ggagacgggg gtgcgctggg tgctggtgca gcaacaccgt      1500
     gcggaccagg tggatccggt caccctcgcc ggcctcgagg tcgtgcacca ggggacgtat      1560
     ctcgtcctct accgcaatcc agccgtgccg ccgagcccgg tggtggtgtc tccggctcga      1620
     tgggcggtgg cggtggcgtt ggtcgtcgcc attgtggtgg tggtagctgc ttttttgcgc      1680
     cggtacgccg gtgggctact gcgtggtaac ctccgctccg aggttcagac attggaggat      1740
     tggcatgcgt aa                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page