(data stored in ACNUC7421 zone)

EMBL: CP000667.PE201

CP000667.PE201       Location/Qualifiers
FT   CDS_pept        232139..232663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52686"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D6"
FT                   /protein_id="ABP52686.1"
FT                   /translation="MSYFAAAVVRDESGWTAAEVNLRGAVDVDGVADRLRDVDPGADLS
FT                   LLFVEAEDEYLVILRLDEGEDLRVFGSDSAYAEETQLGALLVGDLKASVTGLDETEEPR
FT                   AAGGDPESEQPAADPEADPVGDADLLADLGVSGTKLVALCGHEGMLPADVTTEACMVLG
FT                   CADEVEELREV"
     gtgtcgtact tcgctgcggc cgtggtacgc gacgagagcg gctggaccgc cgccgaggtg        60
     aacctccgcg gtgccgttga cgtggacggg gtcgccgacc ggttgcggga cgttgacccc       120
     ggcgccgacc tgtcgctgct cttcgtcgag gccgaggacg agtatctggt gatcctgcgt       180
     ctggacgagg gcgaggacct gcgggtcttc ggctcggact cggcgtacgc cgaggagacc       240
     cagctgggcg cgctactggt cggggacctg aaggcgtcgg tgaccgggtt ggacgagacc       300
     gaggagccgc gcgccgccgg cggtgacccg gagagcgaac agcccgctgc ggatccggag       360
     gcggatccgg tcggggacgc ggacctcctc gccgacctgg gggtatccgg gacgaagctg       420
     gttgcgctct gcggccacga ggggatgctg ccggcggatg tcaccaccga ggcgtgcatg       480
     gtgttgggct gcgccgacga ggtcgaggaa ctgcgtgagg tgtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page