(data stored in ACNUC7421 zone)

EMBL: CP000667.PE212

CP000667.PE212       Location/Qualifiers
FT   CDS_pept        241433..241852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52697"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E7"
FT                   /protein_id="ABP52697.1"
FT                   /translation="MPNRLSRRHQRQDGPARWHPRQRRSYPRQRGVLALTGAGILSRYC
FT                   RLWSGHRSLEHPVSDQKGPLVSISVNLDDVLDKAYESSALADLATAPVAALAGVSEADG
FT                   EALQKAFNIKTIADLAGNKYVRAAQAIVELSRISK"
     atgccgaatc gcctgtcgcg tcgccatcag cgccaggacg ggccggcgcg ctggcacccg        60
     cggcaacggc gctcatatcc acggcaacgg ggcgtgctgg cgctgacggg ggccgggatt       120
     ctcagccggt actgtcgcct ttggtccgga caccgtagcc tggaacaccc cgtttccgac       180
     cagaagggtc ccctcgtgtc gatctctgtg aacctggacg atgtgctgga caaggcctac       240
     gagtccagcg ctctggctga cctggctacc gcccccgtcg ccgcgttggc cggcgtcagc       300
     gaggccgacg gcgaggctct gcagaaggcc ttcaacatca agaccatcgc ggacctggcc       360
     ggcaacaagt acgtccgggc cgcgcaggcc atcgttgagt tgagccgcat cagcaagtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page