(data stored in ACNUC7421 zone)

EMBL: CP000667.PE213

CP000667.PE213       Location/Qualifiers
FT   CDS_pept        242420..244846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0213"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52698"
FT                   /db_xref="GOA:A4X1E8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E8"
FT                   /protein_id="ABP52698.1"
FT                   /translation="MALALYRKYRPRTFAEVIGQEHVTEPLSQALRGGRLNHAYLFSGP
FT                   RGCGKTSSARILARSLNCEHGPTPEPCGTCASCRALATDGAGSIDVIEIDAASHGGVDD
FT                   ARELREKAFFAPAQSRFKIYVIDEAHMVSSAGFNALLKLVEEPPEYVKFIFATTEPEKV
FT                   LGTIKSRTHHYPFRLIPPKVLRPYLEQLCQAEGVQVEPAVFPLVVRAGGGSARDSLSVL
FT                   DQLIAGAGPEGVIYARAAALLGVTDSALIDEMCDALAAGDGAAAYATVDRIVGAGHDPR
FT                   RFAADLLERLRDLIILQRVPDAAPKGLVDGPDDQIERMTAQAQRLGPGTLSRCADIVHD
FT                   GLVEMRGATAPRLLLELICARLLLPRIDDSTGGLLQRLETLERRHTHAGADVPPAVPTP
FT                   ATGSSPAAAVPPAVPTPATGSSPAPAVPTPAAGAPPAPAVGSPPRPVGTAVSASMDGPA
FT                   VSDGPRRASPRPAVMPDPATPEPPRPGTTGQGPLDAAAVRRRWPEVVGLVGRKSKKAAA
FT                   WAREATVHEVDGQTLVLAFRYPFHAQALANEPDLLIESLHEELGERWQIRCEVAGERVG
FT                   GPAAGPRAAGPARPATAPARPDPAVAPAAPPRSSAGDGAVDGMAPRSAGSADEQEWPEP
FT                   ARPGGAAPPEPAAGTAEEWPATARPGGAGVDATAAAAAGPGGSTTGGGRASGAGVAPAA
FT                   SAVSRPPVTSGARASSAIAAARAAAAGGAQRSAASPRRTAEPDWAGEPPYDPDYDGVPR
FT                   GGAAPAVVHEGFDPGDEPLDEVIDERTARQSSEEQAVRLLREAFGAERIDEVKSR"
     gtggcgctgg cgctctaccg caagtaccgg ccacgtacct tcgccgaggt tatcgggcag        60
     gaacacgtca ccgagccgtt gtcgcaggcg ctgcggggcg ggcggctcaa tcacgcgtac       120
     ctcttctctg ggccgcgtgg ctgcggcaaa acatccagtg cccgcatcct ggcccggtcg       180
     ctcaactgcg agcacggccc gaccccggag ccctgtggga cctgtgcctc ctgtcgggcg       240
     ctggctaccg atggcgccgg ttcgatcgac gtcatcgaga tcgacgcggc cagtcacggc       300
     ggtgttgacg acgcgcggga gctgcgcgag aaggcgttct tcgcgccggc gcagagccgc       360
     ttcaagattt acgtcatcga cgaggcgcac atggtctcgt cggccggctt caacgccctg       420
     ctcaagctgg tcgaggagcc cccggagtac gtcaagttca tcttcgccac caccgagccg       480
     gagaaggtcc tcggcacgat caagtcgcgg acccaccact acccgttccg gctgatcccg       540
     ccgaaggtgc tccggcccta cctggaacag ctctgccagg ccgagggtgt ccaggtcgag       600
     ccggcggtct ttcccctcgt cgtgcgggcc ggtggtggca gcgcccggga cagtctttcg       660
     gtgctcgacc agctcatcgc cggggcaggt ccggagggcg tcatctacgc ccgggccgcc       720
     gcgctgctcg gggtcaccga ctcggcgctg atcgacgaga tgtgcgacgc gctcgccgca       780
     ggggacggtg cggcggcgta cgccaccgtc gaccggatcg tcggcgctgg ccacgatccg       840
     cgccggttcg ccgctgacct gctggagcgg ctgcgtgatc tgatcatcct ccagcgggtg       900
     ccggacgccg cgccgaaggg cttggtggac ggcccggacg accagatcga gcggatgacc       960
     gcccaggcgc agcggcttgg gccgggcacc ctgtcgcggt gcgccgacat cgtgcacgac      1020
     ggtctggtcg agatgcgagg tgccaccgcg ccccggctac tgctggaact gatctgcgcc      1080
     cggctgctgc tgcctcggat tgacgactcg accggtggcc ttctccaacg cctcgaaact      1140
     ctggagcgtc ggcacaccca cgccggcgcc gacgtcccgc cagctgttcc cacgccggct      1200
     accggctcgt cccccgcggc ggccgtcccg ccagctgtcc ccacgccggc gaccggctcg      1260
     tcccccgcgc cagctgtccc cacgccggct gctggtgcgc cgcccgcgcc ggccgtcggc      1320
     tcgccgcccc gtccggtggg taccgcggtg tctgcgagca tggatggtcc ggccgtgtcc      1380
     gacggtcccc gccgtgcctc ccctcggccg gcggtcatgc ccgacccggc cacccccgag      1440
     ccgccccgcc cgggtacgac cggtcagggt ccgctcgacg cggccgcggt acgtcggcgc      1500
     tggccggagg tggtcggtct ggtgggccgc aagagcaaga aggccgctgc ctgggcgcgt      1560
     gaggcgacgg ttcacgaggt cgacggtcag accctcgtgt tggccttccg ctatccgttt      1620
     catgcccagg ccctcgccaa cgaaccggat ttgctgatcg agtccctcca tgaggaactg      1680
     ggtgagcgct ggcagatcag gtgcgaggta gctggtgagc gggtcggcgg acccgccgct      1740
     gggccccgcg cagccggccc ggcccggccc gcgaccgcgc cggcacggcc ggacccggcg      1800
     gtggctcccg ccgctccgcc gcgatcgtcg gccggtgatg gggcggtcga tggcatggcc      1860
     ccgcgctccg ctgggtccgc cgatgagcag gagtggccgg agccggcacg ccccggcggg      1920
     gctgccccgc ccgagccggc ggctggcaca gccgaggagt ggcccgcgac ggcccgcccg      1980
     ggtggggcgg gagtggacgc cacggcggca gcagcagcgg ggccgggcgg ctcgaccacc      2040
     ggtggtggcc gggcctccgg cgcgggtgtg gcgcctgccg cttcggccgt atcccggccg      2100
     ccagtgacga gcggtgcgcg ggcgagcagc gcgattgccg ctgcccgggc ggcggctgcc      2160
     ggtggcgcgc agcgttccgc tgcctcgccg cggcggacgg cggagccgga ttgggcaggt      2220
     gagccgccgt acgatccgga ctacgacggc gtgccgcgtg gtggtgccgc ccccgcagtg      2280
     gtgcatgagg ggttcgatcc gggggacgag ccgctggacg aggtgattga tgagcggacc      2340
     gcccgtcagt ccagtgagga gcaggcggtg cggctgctcc gtgaggcgtt cggtgcggag      2400
     cggatcgacg aggtcaagtc ccgttag                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page