(data stored in ACNUC7421 zone)

EMBL: CP000667.PE214

CP000667.PE214       Location/Qualifiers
FT   CDS_pept        244878..245255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0214"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52699"
FT                   /db_xref="GOA:A4X1E9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E9"
FT                   /protein_id="ABP52699.1"
FT                   /translation="MSVRSKSSGKSKEPFVRPGGQPNMQQMLKQAQKMQQQIAKAQAEL
FT                   AEAELTGAAGGGLVTATVAGTGELKSVAIDPKAVDPEDVETLEDLVVAAVRNAAEAARE
FT                   LTDQKMGPVAGGMGGLGLPGF"
     gtgagcgtaa gaagcaagtc gagtgggaag agtaaggagc cgttcgtgcg cccaggtgga        60
     cagccgaaca tgcagcagat gctgaagcag gcgcagaaga tgcagcagca gatcgccaag       120
     gcgcaggccg agctggccga ggcggagctg accggtgccg cgggtggcgg cctggtcacc       180
     gcgaccgtcg ccggcaccgg cgagctcaag tcggtcgcga tcgaccccaa ggcggttgat       240
     ccggaggacg tcgagaccct ggaggatctg gtggtcgctg ccgtgcgtaa cgccgcggag       300
     gcggcccggg agctgaccga ccagaagatg gggccggtgg ccgggggcat gggcggcctc       360
     ggcctgcccg gtttctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page