(data stored in ACNUC7421 zone)

EMBL: CP000667.PE216

CP000667.PE216       Location/Qualifiers
FT   CDS_pept        246131..247792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0216"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52701"
FT                   /db_xref="GOA:A4X1F1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F1"
FT                   /protein_id="ABP52701.1"
FT                   /translation="MRASRPKVAVAAVAVAALAVAGCAESDREDSGGSNNDTLVFGVAG
FT                   DPKVLDPSFASDGESLRVARQVFETLVRPEEGGTKVSPGLAESWTPDEAGTTWTFKLRS
FT                   GVKFHDGTDFDAEAVCVNFNRWYNATGLMQSPDVTAYWQDVMGGFAQNEDEGLSESLFK
FT                   SCTAKDATTVDLTFTRVSSKIPAALMLPSFSIHSPTALEQYDASNVGGTATDVQYPEYA
FT                   TAHPTGTGPFKFKSWDIANKSLTIERNDDYWGEKAKLKTLIFRTIPDENARKQALSSGD
FT                   IQGYDLVGPADVEPLKGEGFNVLTRPAFNILYLGMNQQGNPKLADLKVRQAIAHAINRQ
FT                   ALVDSKLPPGAKVATNFFPDTVEGWNGDVTTYDYDVDKAKQLLAEADATDLTLRFHYPT
FT                   EVTRPYMPNPKDLFELVSADLQAAGITVEPIPLKWSPDYLNATTSGSEHDLHFLGWTGD
FT                   YGDAYNFIGTFFDRQKDEWGFDNPALFEQFQDADSTADMASRVEKYKGLNKTIMDFLPG
FT                   VPISHSPPAIVFGKDVTGIKASPLTDERFAKAEFTS"
     atgcgtgcat ccaggccgaa ggtcgctgtc gcggccgtcg cggtcgcggc cctcgcggta        60
     gccggctgcg ccgagagcga ccgcgaggat tccggtggta gcaacaacga caccctcgtc       120
     ttcggcgtcg ccggagaccc gaaggtgctc gacccgagct ttgccagcga cggcgagtcg       180
     ctgcgcgtgg cccgtcaggt cttcgagacc ctggtccgcc ccgaggaggg tggcaccaag       240
     gtgagcccgg gcctcgcgga gtcctggact ccggacgagg cgggcaccac ctggaccttc       300
     aagctccgct cgggcgtgaa gttccacgac ggcaccgact tcgacgccga ggccgtctgc       360
     gtcaacttca accgttggta caacgccacc ggcctcatgc agagcccgga cgtgaccgcc       420
     tactggcagg acgtgatggg cggcttcgcc cagaacgagg acgaagggct ctcggagagc       480
     ctcttcaagt cctgcaccgc caaggacgcc accacggtcg atctgacctt cacccgggtg       540
     tccagcaaga tcccggccgc cctgatgttg ccgtcgttct ccatccacag cccgacggcg       600
     ctggagcagt acgacgcgag caacgtcggc ggcaccgcga cggacgtcca gtaccccgag       660
     tacgcgaccg cgcatccgac cggcaccggg cccttcaagt tcaagtcctg ggacatcgcc       720
     aacaagtcgc tcaccatcga gcgaaacgac gactactggg gcgagaaagc caagctgaag       780
     accctcatct tccggaccat cccggatgag aacgcgcgca agcaggcgct gagctccggc       840
     gacatccagg gctacgacct ggtcgggccg gctgatgtcg agccgctgaa gggcgagggc       900
     ttcaacgtcc tgacccggcc ggcgttcaac atcctctacc tgggcatgaa ccagcagggg       960
     aacccgaagc tggctgacct caaggtccgg caggcgatcg cccacgcgat caaccggcag      1020
     gccctggtcg actccaagct ccccccgggt gcgaaggtcg cgaccaactt cttcccggac      1080
     acggtcgagg ggtggaacgg cgacgtcacc acctacgact acgacgtcga caaggccaag      1140
     cagctgctgg ccgaggccga cgcgacggac ctgacgctgc ggttccacta cccgaccgag      1200
     gtcacccgtc cgtacatgcc gaacccgaag gatctcttcg agctggtctc ggcggacctc      1260
     caggcggccg gcatcacggt cgagccgatt ccgctcaagt ggagcccgga ctacctcaac      1320
     gccaccacct ccggtagcga gcacgacctg cacttcctcg gctggaccgg tgactacggc      1380
     gacgcctaca acttcatcgg caccttcttc gaccggcaga aggacgagtg gggctttgac      1440
     aacccggccc tcttcgagca gttccaggac gccgactcca ccgcggatat ggcgtcacgg      1500
     gtggagaagt acaagggtct gaacaagacc atcatggact tcctgcccgg ggtgccgatc      1560
     tcgcactcgc cgccggcgat cgtgttcggc aaggacgtca ccggcatcaa ggccagcccg      1620
     ctcaccgacg agcggttcgc gaaggctgag ttcacgtcct ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page