(data stored in ACNUC7421 zone)

EMBL: CP000667.PE217

CP000667.PE217       Location/Qualifiers
FT   CDS_pept        247867..248871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0217"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52702"
FT                   /db_xref="GOA:A4X1F2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F2"
FT                   /protein_id="ABP52702.1"
FT                   /translation="MFRFIVRRLLQLIPTLFGLSLLLFIWVRRLPGGPEDAILGERGTP
FT                   EMRAAIRRSMGLDEPILVQYGRFVQRLLRLDLGTSSSTKRPVVEEFLERFPGTVELTIT
FT                   ALVIAIGVGIPLGYLAARRRGRLLDHLSVGGSLVGICVPIFFLAYVLKAIFSENLGWFP
FT                   SSGRQDPTLDATRVTNFFVLDGLMTREWDAAMDALWHLVLPGLALASIPLAIIVRITRA
FT                   SVLEVLNEDFVRTAEAKGLTERTVRGRHVLRNSLLPVVTSIGLLTGGLLSGAVLTETVF
FT                   AFSGIGAFIYEAIGQRDYPVLLGFIMIISVVYVLVNLLVDLSYSLIDPRVRVR"
     gtgtttcggt ttatcgtcag acgcctgctc cagctgatac ccacgctgtt cgggctttcg        60
     ctcctgctct tcatctgggt tcgtcgcctg ccgggtggcc ccgaggacgc catcctcggc       120
     gagcgtggca cccccgaaat gcgcgcggcg attcgccgta gcatgggtct cgacgagccg       180
     atcctggtgc agtacggccg cttcgtgcag cggctccttc gcctggacct gggcacctcg       240
     tcgtcgacca aacgtccggt ggtcgaagag ttcctggagc gtttccccgg caccgtggag       300
     ttgacgatca ccgccctggt gatcgcgatc ggcgtcggca ttcccctcgg ctacctggcc       360
     gcccgccgtc ggggccggct actcgaccat ctctcggtcg gcggatcgct ggtcgggatc       420
     tgcgtcccta tcttcttcct ggcctacgtc ctgaaggcga tcttctcgga gaacctgggc       480
     tggttcccgt ccagcggccg gcaggatccg accctcgacg cgacccgggt cacgaacttc       540
     ttcgtcctcg acgggctgat gacccgggag tgggatgccg cgatggacgc gctttggcat       600
     ctggtgctgc cggggctcgc gctggccagc atcccgctgg cgatcatcgt tcggatcacc       660
     cgggcgagcg tgttggaggt gctcaacgag gacttcgtgc ggaccgccga ggcgaagggg       720
     ctgaccgagc ggaccgtgcg gggacggcat gtgctgcgca actcgctgct gccggtggtc       780
     acctcgatcg gcctgctcac cggggggctt ctctcgggcg cagtgctgac cgagacggtc       840
     tttgccttct ccggcatcgg ggccttcatc tacgaggcga tcggccagcg tgactacccg       900
     gtgctgctcg gtttcatcat gatcatttcg gtggtgtacg tgctggtgaa cctcctggtt       960
     gacctctcct acagcctgat cgacccgagg gtgagggtcc gatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page