(data stored in ACNUC7421 zone)

EMBL: CP000667.PE218

CP000667.PE218       Location/Qualifiers
FT   CDS_pept        248868..249830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0218"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52703"
FT                   /db_xref="GOA:A4X1F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F3"
FT                   /protein_id="ABP52703.1"
FT                   /translation="MTITGKKERLDRLAELVNRDDERGVSLWQEAFRRLRRNPAAIIGA
FT                   IILAIFVLVALIGPFFVPYEPKDTIGIREGLVKSGQGIIPGASAEHWFGYDHQGRDVFS
FT                   RMIVGARQTLLVGVVATLIGLAVGALIGGVAGAAAGLGGRWGRAVDNVLMRVIDMMLAL
FT                   PSLLLAVSIAALLGASLQTVMIAVGMVSVPVFARLLRVSMIAQANSDYVLAATSLGVRK
FT                   PKIALTHILPNSLAPVIVQATLTLATAIIEAAALSFLGLGNPDTAQPEWGVMLADAQPY
FT                   LGIRPALAIFPAVAIIITALGFTLLGEAMREALDPKLRK"
     atgacgatca caggtaagaa ggagcggctg gaccggctcg ccgagttggt gaaccgggac        60
     gacgagcggg gggtcagcct ctggcaggag gcgttccgac gactgcggcg gaaccccgcc       120
     gccatcatcg gcgcgatcat tctggcgatc ttcgttctgg tggcgctgat cggcccgttc       180
     ttcgtcccct acgagccgaa ggacaccatc ggaattcgcg agggcctggt gaagtcgggg       240
     cagggcatca tccccggcgc ctccgccgag cactggttcg gctacgacca ccagggccgg       300
     gacgtcttca gccggatgat cgtcggggcc cggcagaccc tgctggtcgg cgtggtcgcc       360
     acgctgatcg ggttggccgt gggcgccctg atcggcgggg tggccggcgc ggctgccggt       420
     ctgggtggcc gctgggggcg cgcggtcgac aacgtgctca tgcgcgtcat cgacatgatg       480
     ctggcactgc ccagcctcct gctcgcggtg agcattgccg ccctgctcgg ggcgagtctc       540
     caaaccgtca tgatcgcggt cggcatggtg tcggtgccgg tcttcgcccg gctgctgcgg       600
     gtctcgatga tcgcgcaggc caacagcgac tacgtgctcg cggccacctc gctcggcgtc       660
     cggaagccga agatcgcgct gacgcacatc ctgccgaact cgctggctcc ggtcatcgtg       720
     caggccacgc tgaccctggc caccgcgatc atcgaggccg ccgcgctctc cttcctcggc       780
     ctcggcaacc cggacacggc gcagcccgag tggggtgtca tgctcgccga cgcgcagccg       840
     tacctcggca ttcgacccgc actggcgatc ttcccggcgg tagcgatcat catcaccgcg       900
     ctcggtttca ccctgctcgg tgaggcgatg cgtgaggccc tcgacccgaa gctgcggaag       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page