(data stored in ACNUC7421 zone)

EMBL: CP000667.PE231

CP000667.PE231       Location/Qualifiers
FT   CDS_pept        complement(265739..266038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52716"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G6"
FT                   /protein_id="ABP52716.1"
FT                   /translation="MIITFEAELWSWTARRADSWTFVSLPTDVSEEIRELPGPPRRGFG
FT                   SLRVRVTVGDSTWATSIFPDKERSCYVLPVKRSIREAEAIEAGDVTTVRLELLD"
     gtgatcatca ccttcgaagc cgagctgtgg agttggactg cccgacgggc ggacagttgg        60
     accttcgtca gcctgcccac cgatgtgtcg gaggagatcc gtgagctgcc cgggccgccg       120
     cgtcgtggtt tcggctcgct gcgggtccgg gtcacggtcg gtgacagcac ctgggcgaca       180
     tcgatattcc cggacaagga acgaagctgc tacgtgctgc ccgtcaaacg atccatccgc       240
     gaggcggaag ccatcgaggc cggcgacgtc accaccgtac gcctcgaact cctcgactag       300
//

If you have problems or comments...

PBIL Back to PBIL home page