(data stored in ACNUC7421 zone)

EMBL: CP000667.PE232

CP000667.PE232       Location/Qualifiers
FT   CDS_pept        266097..267104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0232"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52717"
FT                   /db_xref="GOA:A4X1G7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G7"
FT                   /protein_id="ABP52717.1"
FT                   /translation="MRAPTRGGVVVLAGPRGYCRVMPLSSHEVELFEHSRARLEAIAYR
FT                   LLGSATDAEDAVQDTFLRWQAADRSHVQTPEAWLTKVLTNLCLNQLTSARARRETYVGM
FT                   WLPEPVLAGDRMLGPVDTVERRESVSMAVLALMERLSANERVVYVLREAFGYSHGEIAE
FT                   ILDLTESNCQQIYRRAKQHIITSRVRTEADASSTRKIVEEFLVAATSGKIQRLVELLAD
FT                   DATSIGDGGGKIPARTTPIIGALTVARFLRGLFKPTEARRDLIGGRPAVYASTVNGGPA
FT                   VVFVVGDQVVGVMALHVTSTGISSIHTQVNPDKLARITRLWAGSEHGEPLLEAW"
     gtgcgtgcgc caacgcgggg tggagtcgtg gtgctcgcgg gaccgcgtgg ctactgtcgg        60
     gtcatgccgc tgagttcgca cgaggtcgag ctgttcgagc actccagggc ccgcctggag       120
     gcgatcgcct accgtctgct cggctcggcg accgatgcgg aggacgccgt ccaggacacg       180
     tttctgcgtt ggcaggccgc cgatcgcagc cacgtccaga cgcccgaggc gtggctgacg       240
     aaggtgctca ccaatctgtg cctcaaccag ctcacctccg cgcgggcccg gcgcgagacg       300
     tatgtgggca tgtggcttcc cgagccggta ctcgccggag accggatgct cggcccggtc       360
     gacaccgtcg agcgacggga gtcggtctcg atggcggtgc tcgccctcat ggagcggctc       420
     tcggccaatg agcgggtcgt gtatgtgctc cgagaggcat tcggctactc gcacggtgag       480
     atcgccgaga tcctcgacct caccgagtcg aactgtcaac agatctaccg gcgtgccaag       540
     cagcacatca tcaccagtcg ggtgcgcacg gaggcagacg cgagcagcac gcggaagatc       600
     gtcgaggagt tcctcgtcgc ggccaccagt ggcaagatcc agcggttggt cgagctgttg       660
     gccgatgacg cgacgagtat cggtgatggc ggtggcaaga tcccggcccg gaccacgccg       720
     atcatcggag cgctgacggt ggcgaggttc ctccgcggtc tgttcaagcc caccgaagcc       780
     agacgcgacc tgatcggcgg ccggcctgcc gtctacgcca gcaccgtcaa cggcgggccc       840
     gcggtggtgt tcgtggtcgg tgaccaggtc gtcggtgtga tggccctgca cgtgacctcc       900
     acgggcatct cgtccatcca cacccaggtc aaccccgaca agcttgcccg gatcacccgg       960
     ctctgggccg ggtccgagca cggtgagccc ctcctcgaag cctggtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page