(data stored in ACNUC7421 zone)

EMBL: CP000667.PE237

CP000667.PE237       Location/Qualifiers
FT   CDS_pept        269916..271202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0237"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52722"
FT                   /db_xref="GOA:A4X1H2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H2"
FT                   /protein_id="ABP52722.1"
FT                   /translation="MEQLVRRLGVTDAVVIGLGAMLGAGVFVVFAPAAAAAGGNGLLLA
FT                   LALAGLVAFCNATSSARLAAHYPESGGTYVYGRERLGPFAGFLAGWGFVVGKTASCAAM
FT                   ALTVGAYLWPGRARLVAVVAIAAVTAVNLRGVGKTAQATKALVGVVLGVLSLVVVVGLA
FT                   GFASERIGDSGSVGGVVFSDGGGAGIHGVLTAAGLLFFAFAGYARIATLGEEVREPERT
FT                   IPRAVPLALGVVLAIYLVLAVITLGVLGPDRLAASAAPLADVVTTVGLPGLAWVVRAGA
FT                   AVAVTGVLLSLLAGVGRTLLAMARRRDVPAGLATVHRAHQVPYRAELVVAVVVAAVVLV
FT                   GDVRGAIGFSSCTVLVYYAITNASALTLGRDPGRRLPVRLLAVLGLAGCVTLAVSLPLA
FT                   SVAAGFGVLAVGAGWYALRRRYIDRSGGR"
     gtggagcagc tggtacggcg gttgggtgta accgatgcgg tggtcatcgg gctgggggcg        60
     atgctcgggg cgggcgtctt cgtggtcttc gccccggccg cggcggcggc cggcgggaac       120
     ggtctgctgc tggcgttggc cctggccggg ctggtggcct tctgcaacgc gaccagctcg       180
     gcccggttgg ccgcccacta ccccgagtcc ggcggcacgt acgtctacgg gcgggagcga       240
     ctcggcccgt tcgccggatt cctggccggc tggggcttcg tggtcggcaa gaccgcaagc       300
     tgcgcggcga tggcactgac ggttggggcg tacctctggc cgggccgggc ccggctcgtc       360
     gccgtcgtcg ccatcgcggc cgtcaccgcc gtgaacctgc gcggtgtggg gaagaccgcg       420
     caggccacga aggcgcttgt cggggtggtg ctgggggttc tgtccctggt cgtggtggtc       480
     ggcctggccg gcttcgcatc ggagcggatc ggcgattccg gctcggtcgg cggcgtggtg       540
     ttcagcgatg gtggcggtgc cgggatacac ggtgtgctga ccgcggcggg gctgctcttc       600
     ttcgccttcg ccgggtacgc ccggatcgcc actctcggcg aagaggtacg cgaaccggag       660
     cggacgatcc cccgagcggt gccgctggcg ctgggtgtgg tgctggcgat ctacctggta       720
     ctggcagtga tcacgttggg ggtgctcggc ccggaccggc tggccgcctc cgccgcgccc       780
     ctggccgacg tggtgaccac cgtcgggctg cccggcctcg cctgggtggt ccgggccggt       840
     gcggccgtgg cggtgaccgg ggtgctgctg tcgctgctcg ccggcgtggg ccggaccctg       900
     ctggcgatgg cccgccgacg ggacgtaccg gccggcctgg ccaccgtgca ccgggcgcac       960
     caggtgccgt accgcgccga gctggtggtg gcggtggtgg tggcggccgt ggtcctcgtc      1020
     ggcgacgtgc gcggggcgat cggcttctcc agctgcaccg tgctggtgta ttacgcgatc      1080
     accaacgcct cggcgctcac cctcggccgt gatccgggcc gtcggctgcc ggtacggctg      1140
     ctcgccgtgc tggggctggc cggctgtgtc acgctggcgg tcagcctgcc tctcgccagc      1200
     gtcgcggcgg gattcggcgt gctcgccgtc ggcgctggct ggtacgcgct gcgtcggcgg      1260
     tatatcgatc ggtccggcgg tcgttga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page