(data stored in ACNUC7421 zone)

EMBL: CP000667.PE239

CP000667.PE239       Location/Qualifiers
FT   CDS_pept        272669..273139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52724"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H4"
FT                   /protein_id="ABP52724.1"
FT                   /translation="MQTFLPYPDFLASAASLDQRRLGKQRVEAIQVLRGLTRPGYGWRH
FT                   HPAVKMWAGYEEALTRYGLDVCAVWCEPGRADTCAATLVTDFAAARGVRTVRTQAELAD
FT                   AGELPPWLGRDDLHLSHRSSLLRKDPEHYRPQFGDIPIDLDYVWPRSDRAPG"
     gtgcagacct tcctcccgta cccggacttc ctggccagcg cggcctcact ggaccaacgt        60
     cggctcggca aacagcgagt ggaggcgatt caggtgctgc ggggcctgac tcgtccaggt       120
     tatggctggc ggcaccatcc ggcggtgaag atgtgggccg gctacgagga ggcgctgacc       180
     cggtacgggc tggacgtgtg cgcggtctgg tgcgagccgg gccgagccga cacctgcgcc       240
     gcgacgctgg tgaccgactt cgccgccgcc cggggcgtgc gcaccgttcg tacccaggcc       300
     gaactggccg acgccggtga gctaccgccc tggctgggcc gtgacgacct gcacctgagc       360
     catcgttcgt cgttgctgcg caaggacccg gagcactatc gcccgcagtt cggtgacatc       420
     ccgatcgacc tggactacgt ctggccccgc tccgatcgcg ccccgggcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page