(data stored in ACNUC7421 zone)

EMBL: CP000667.PE242

CP000667.PE242       Location/Qualifiers
FT   CDS_pept        275688..277694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0242"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52727"
FT                   /db_xref="GOA:A4X1H7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H7"
FT                   /protein_id="ABP52727.1"
FT                   /translation="MRHMTGPFDRAWWTGRRLRGNSDPWAHYVVCGHDALAYWVVRSLL
FT                   ATEPQLARIRITLVVPERQRTDSPDGRDLDGIEVIRADRLDEVTFRDARLDRAEGLALL
FT                   HQDDVGNMHAALCAQEVQPRLRLVVRMFNTSLANGVRQIFPDSAVLSDAAMAAPAFVAA
FT                   ALGEVAPAHFRHGGRTLYVARRVDLRDEDIVCPVADIRDPREVRVLPADETSADVVLAE
FT                   AAGTPPGTEVAARRLRRARRWRRPVTMLLRAVRGFATRRIGLAVLVLLAVIVVLGGLYA
FT                   STAEVSWGEALYLTLVTALSGQDPDAAKPLGEQVLQVVLNLSGLALIPLVTAVVVDGLV
FT                   NARLALHSGRPLTDRSGHVVVVGLGNIGTRVTAQLRDFGVEVVAIDKNADARGAELARR
FT                   LGVPLVVGDASTEETLRAASVGTCQALVVVSTDDGVNLRAALTARSFNDDVQVVLRLFD
FT                   GHFAERVQRSFGIGVSRSVSYLAAPSFAGALLDRAVIATISVGRHALLVTEVPVAAGSS
FT                   LDGQPLATVDRTGSVRLLAHARSGQRYEWELDRRLVIMAGDRLTVVARRAGLNALLREA
FT                   GPLNPEVPASPDGSSPEPASTPAGSPPVGSSPETASLPQPASPPVGSSPEAPSSPEVAS
FT                   PSEGSSAPAGPPLPRLPEGEVGGSVDQRPVSSE"
     atgcgtcaca tgaccgggcc cttcgatcgt gcatggtgga ccgggcgccg gcttcgaggc        60
     aacagcgacc cctgggccca ctacgtggtc tgtggccacg acgccctggc gtactgggtg       120
     gtcaggtcgc tgctcgccac cgagccgcag ctcgcccgga tccggatcac gctggtggtg       180
     cccgagcggc agcggaccga cagcccggac ggtcgagatc tcgacggcat cgaggtcatc       240
     cgggccgacc ggctcgacga ggtgacgttt cgcgatgccc gcctggaccg ggcggagggt       300
     ttggcgctgc tgcaccagga cgacgtgggc aacatgcacg cggcgctctg tgcgcaggag       360
     gtgcagccga ggctgcggtt ggtggtccgg atgttcaaca ccagcctggc caacggggta       420
     cgacagatct tccccgactc ggcggtgctc tccgacgccg cgatggcggc ccccgccttc       480
     gtcgctgccg cgctgggcga ggtcgcgccg gctcacttcc gacacggcgg acggactctg       540
     tacgtggccc gccgcgtcga tcttcgagac gaggacatcg tctgcccggt ggcggatatc       600
     cgggacccgc gggaggttcg ggtcctgccc gccgacgaga cctccgccga cgtggtgctc       660
     gccgaggcgg ccggtacacc accgggaacc gaggtggcag cgcgccgact gcgtcgggcc       720
     cggcggtggc gccggccggt cacgatgctg ctccgggcgg tccggggctt cgccacccgc       780
     aggatcggcc tcgccgtgtt ggtgctgctg gcggtgatcg tcgtgctcgg cggcctctac       840
     gccagcaccg ccgaggtgag ctggggggag gcgctctacc tgaccctggt caccgccctg       900
     agcgggcagg acccggacgc cgccaagccg ctcggcgaac aggttctcca ggtggtgctc       960
     aatctctccg gcctggcgct gatcccgttg gtcaccgccg tggtggtgga cggcctcgtc      1020
     aacgcccggc tggcgctcca ctccgggcgg cccctgactg accgttccgg gcacgtggtc      1080
     gtggtcggcc tcggcaacat cggcacgcgg gtgaccgccc agctccgcga cttcggtgtc      1140
     gaggtggtcg ccatcgacaa gaacgcggac gcacggggtg ccgagctggc ccggcggctc      1200
     ggcgtgccgc tggtggtggg ggacgcctcc accgaggaga ccctgcgcgc cgcctcggtc      1260
     ggcacctgcc aggccctcgt cgtggtctcc accgacgacg gggtgaacct acgggccgcg      1320
     ctgacggccc gctccttcaa cgacgatgtt caggtggttc tgcggctctt cgacgggcac      1380
     ttcgccgagc gcgtccagcg gtccttcggc atcggcgtct cgcggagcgt gtcgtacctg      1440
     gcggcaccgt cgttcgccgg tgccctgctg gaccgtgccg tcatcgccac catctcggtc      1500
     ggccggcacg ccctgttggt caccgaagtt ccggtagccg ccggctcctc gctcgacggt      1560
     cagccgctcg ccaccgttga ccgcacgggg agtgtccggc tactcgccca cgcccgctcc      1620
     ggtcagcggt acgagtggga gctcgaccgg cggttagtga tcatggcagg ggaccggctg      1680
     acggtggttg cccggcgggc cgggctgaac gccctgctcc gtgaggccgg ccccctcaat      1740
     ccggaggttc ccgcgtcccc ggatggttcg tccccggagc ccgcatcgac tccggccggt      1800
     tcacccccgg tcggttcgtc cccggagacc gcgtcactgc cgcagcccgc atcgcccccg      1860
     gtcggttcgt ccccggaggc tccatcgtcc ccggaggtcg catcaccctc ggagggctca      1920
     tcagccccgg ccggcccgcc gctgccccgc ctgccggagg gggaggtggg cggctcggtt      1980
     gatcagcggc cggtctcctc cgagtag                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page