(data stored in ACNUC7421 zone)

EMBL: CP000667.PE252

CP000667.PE252       Location/Qualifiers
FT   CDS_pept        complement(286531..286746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52737"
FT                   /db_xref="GOA:A4X1I7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I7"
FT                   /protein_id="ABP52737.1"
FT                   /translation="MLQRLHETGFRAEHAYLAGFVSIGLSFGSWFLSKHLERAGMARAD
FT                   RWGIFIGEWAPTFFAIGNGLRMHEKR"
     atgttgcagc gcttgcacga gaccggcttt cgagcggagc acgcctatct cgcgggtttc        60
     gtaagcattg gcctatcgtt tggcagttgg ttcctctcca agcacctgga acgggccggc       120
     atggcccgcg ccgaccgctg ggggatcttc atcggcgagt gggctccgac cttcttcgcc       180
     atcggcaacg gcctgcgcat gcacgaaaag cgctga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page