(data stored in ACNUC7421 zone)

EMBL: CP000667.PE256

CP000667.PE256       Location/Qualifiers
FT   CDS_pept        290727..293573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: alpha/beta hydrolase fold; peptidase S15; ABC
FT                   transporter related; X-Pro dipeptidyl-peptidase C-terminal
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52741"
FT                   /db_xref="GOA:A4X1J1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J1"
FT                   /protein_id="ABP52741.1"
FT                   /translation="MRSPSPAAWVRRVLPTRRRALAAAVVVVLLAAGVVAGTLRPSEPD
FT                   LRTEAALVTVRSGPTGDEPVELDTTLYLPPAATADAPVPAVLLGHGFGGTKESVRADAE
FT                   EFADRGYAVLTWTARGFGRSGGQIHLDHPDYEVRDAQRLLDWLAARPEVVTDAAGDPRV
FT                   GVVGGSYGGALALLLAAQDQRVDAIVPMITWNDLARSFLPENSGEGPEQGVFKKGWAGL
FT                   FFGSGGNAGPASVGGSGPAGGLAPGGGSVPGGSLPENAATAAGAIDPSCGRFAADVCAA
FT                   YLRIATTGRADPDAVALLRRSSPAGKLDRIEAPTLLVQGAADTLFPLSEADANARGIAA
FT                   TGTPVQVAWFTGGHDGGDGPKTDSDRVRNLTVRWLDHYVKGEGAAPADDFTFSRIAGFD
FT                   ALDRGLVASGFRATGYPGLTGTDQRPVSVSGPAQSIANPPAGNPAAISSVPFAGDLSSL
FT                   LDGVAGDIPGQHARFESAPLPAAVDVVGAPTVSIRAASPTGTAVLFVKLYDVDAGGSAT
FT                   LPNGLVAPIRLEGLPAAVEDAEPVTVTLPAIVRRIEAGHRLRVVVATSDQAYATPVEPA
FT                   VYSVALASEAVTLPTVASEPIPTDAVVWRWVLVGLLAAIVVGLVVVVAVLRHRHRRRES
FT                   RVHPTYAGVPLAVRDLRKEYADGFVAVSNVDFEVHHGQVVGLLGPNGAGKTTTLRVLMG
FT                   LTQPTAGEVYVFGHRLVPGAPVLSRIGALVEGPGFLPHLSGLDNLKAYWRATGRPWADA
FT                   HFDEALEIAGLGTSVHRKVRTYSHGMRQRLAIAQAMLGLPELLVLDEPTDGLDPPQIAE
FT                   MRRVLLRYATGGRAVLVSSHLLAEVEQTCTHAVVVNKGQIVASGPVEEIVGESPSVLIE
FT                   VTDPVAAREVLDRLTGVSVLPDGDGQLVVDTNGTARSEVVAELVRAGIGVDRVVPRRRL
FT                   EDAFLALVGDNSRGSGDR"
     atgagatcgc cgtcaccggc cgcgtgggtc cggcgtgtcc tgcccacccg tcggcgtgcg        60
     ctggccgcgg cggtggtcgt cgtcctgctc gccgccggag tagtagccgg aaccctccga       120
     ccctccgagc cggacctgcg caccgaggcg gcgctggtca cggtccggtc cgggccaacc       180
     ggtgacgagc cggtcgagtt ggacaccacg ctgtacctgc cccccgccgc gaccgccgac       240
     gccccggtgc cggcggtgct gctcgggcac ggcttcggcg gtaccaagga gtcggtccgc       300
     gccgacgccg aggagtttgc cgaccggggg tacgcggtgc tgacctggac cgcgcggggc       360
     ttcggccgca gcggcgggca gatccacctg gaccatccgg actatgaggt ccgcgacgcg       420
     cagcgcctgc tggactggct ggccgcccgc ccggaggtcg tcaccgacgc cgccggtgac       480
     ccgcgagtgg gggtggtcgg cggctcctac ggcggtgcgc tggcgctcct gctcgccgcg       540
     caggaccagc gggtcgatgc gatcgtgccg atgatcacct ggaacgacct ggcccgctcc       600
     ttcctgccgg agaacagcgg cgaggggccg gagcagggag tgttcaagaa ggggtgggcg       660
     gggctcttct tcggcagcgg cggcaacgcc ggccccgcct cggtcggtgg ctccggcccg       720
     gccggcggcc ttgcccccgg tggcggttcc gtcccgggcg gctccctccc ggagaacgcg       780
     gccaccgcgg ccggcgccat tgacccctcc tgcgggcggt tcgccgccga cgtgtgcgcc       840
     gcgtacctac ggatcgccac caccgggcgg gccgacccgg acgccgtcgc actgctgcgc       900
     cgctccagcc cggccgggaa gctcgaccgg atcgaggcgc cgacgttgct ggtgcagggg       960
     gcagccgaca ccctcttccc gctctccgag gcggacgcga acgcccgggg aatcgccgcg      1020
     accggcaccc cggtccaggt ggcctggttc accggtgggc acgacggcgg cgacggcccg      1080
     aagaccgact cggaccgggt gcggaacctg accgtgcggt ggctcgacca ctacgtcaag      1140
     ggcgagggcg cggcccccgc cgacgacttc accttctccc ggatcgccgg gttcgacgca      1200
     ctcgaccgag gtctggtcgc cagcggcttc cgcgccaccg gatacccggg cctcaccggt      1260
     accgaccagc gcccggtgtc ggtgagcggc ccggcgcagt cgatcgccaa cccgccggcc      1320
     ggcaaccctg ccgcgatctc gtcggtgccc ttcgccgggg atctctcgtc gctgctcgac      1380
     ggggtggccg gagacatacc cggccagcac gcccggttcg agtccgcgcc cttgccggcg      1440
     gccgtggatg tggtcggcgc gccgaccgtc tccattcgag ccgcgtcccc gaccggcacg      1500
     gccgtactct tcgtcaagct ctacgacgtt gacgctggag ggtcggcgac cctgccgaac      1560
     gggctggtcg cgccgatccg gctggagggg ctaccggcgg ctgtcgagga cgccgaaccg      1620
     gtcaccgtca ccctgccggc gatcgtccgt cggatcgagg ccgggcaccg gctgcgcgtc      1680
     gtggtggcga cctccgacca ggcgtacgcc accccggtcg aaccggccgt ctacagcgtg      1740
     gccctggcga gcgaagcggt caccctgccc acggtcgcca gcgagccgat ccccaccgac      1800
     gccgtcgtct ggaggtgggt actcgtcggc ctgctcgccg cgatcgtggt cgggctcgtc      1860
     gtggtcgtcg ccgtcctgcg ccaccgacac cggcggcggg agagcagggt ccacccgacg      1920
     tacgcgggcg tcccgctcgc cgtccgggat ctgcgcaagg agtacgcgga cggctttgtc      1980
     gccgtctcca acgtcgactt cgaggtgcac cacgggcagg tggtgggcct gctcggcccg      2040
     aacggcgcgg gcaagaccac cacgctgcgg gtgctgatgg ggctgaccca gccgaccgcc      2100
     ggcgaggtct acgtcttcgg gcaccggctg gtgccgggcg ccccggtgct gtcccggatc      2160
     ggagccctgg tggagggccc cggtttcctg ccgcacctgt ccgggctgga caacctgaag      2220
     gcgtactggc gggcgaccgg gcggccgtgg gccgacgcgc actttgacga ggcgttggag      2280
     atcgccgggt tgggtacctc ggtgcaccgg aaggtccgga cctacagcca cggcatgcgg      2340
     cagcggctgg cgatcgcgca ggcgatgctc ggcctgccgg agctgctggt gctcgacgag      2400
     ccgaccgacg gcctggaccc gccgcagatc gccgagatgc gccgggtcct gctgcggtac      2460
     gccaccggtg gccgggcggt gctggtctcc agccacctgc tcgccgaggt ggagcagacc      2520
     tgcacccacg cggtggtggt gaacaagggc cagatcgtcg cgtccggccc ggtcgaggag      2580
     atcgtcggcg agtcgccgag cgttttgatc gaggtcaccg atccggtggc cgcgcgggag      2640
     gtgctggacc ggctgacggg tgtctcggtg ctgcccgacg gcgacgggca gctcgtggtg      2700
     gacaccaacg gcaccgcccg tagcgaggtg gtcgccgagc tggtgcgggc cggcatcgga      2760
     gtggaccggg tggtgccccg gcgtcggctg gaggacgcgt tcctggccct ggtcggcgac      2820
     aactctcggg gaagcgggga tcgatga                                          2847
//

If you have problems or comments...

PBIL Back to PBIL home page