(data stored in ACNUC7421 zone)

EMBL: CP000667.PE257

CP000667.PE257       Location/Qualifiers
FT   CDS_pept        293573..294472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52742"
FT                   /db_xref="GOA:A4X1J2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J2"
FT                   /protein_id="ABP52742.1"
FT                   /translation="MARTTVEPGTGDSGGTPSGAAAGYRPFATLPFGAEFRRQASRRRT
FT                   QLALGFLVLLPLIILIAFQFGSDDDDNGRGEFGSLVEFATSGGLNFTLFTLFVSASFLL
FT                   VVVVALFCGDTVASEASWGSLRYLLAVPVPRARLLAVKLLVALTYSGMALLLLAGTALL
FT                   LGTVRYGWEPLRSTVAAELEPGEGLLRLLAVLGYLAVVLLVVAGLAVLLSVSTDAALGA
FT                   VGGAVLLWILSSILDQITALGVLRTFLPTHYSTAWLGLLSTPIQTDDVVRGAISAISYA
FT                   TLFWGLAFWRFTRKDIVS"
     atggcgcgaa cgacggtcga gcccggtacg ggcgattccg gtggcacccc gtccggcgcg        60
     gcggcgggct accggccctt cgccacgctg ccattcgggg ccgagttccg gcggcaggcg       120
     tcccggcggc ggacccagct cgcgctgggc ttcctggtgc tgctgccgct gatcatcctg       180
     atcgcgttcc agttcggctc cgacgacgac gacaacgggc gcggtgaatt cggcagcctg       240
     gtcgagttcg ccacctccgg tggactgaac ttcaccctct tcaccctctt cgtctccgcg       300
     tcgttcctac tggtggtcgt ggtggcgctc ttctgcggcg acacggtggc cagtgaggcc       360
     agctggggca gcctgcgcta cctgctcgcc gtgccggtgc cgcgggcccg gctgctcgcg       420
     gtgaagctgc tggtggcgct cacctactcg ggcatggcgc tgctcctgct cgccggcacc       480
     gcgctgctgc tcggcaccgt gcggtacggg tgggagccgc tgcgcagcac ggtcgccgcc       540
     gagctggagc cgggggaggg gctgctgcgg ttgctggcgg tgctcggcta cctggccgtg       600
     gtgctgttgg tggtggcggg cctggccgtg ctgctgtcgg tgtcgacgga cgccgcgctg       660
     ggcgcggtcg gtggggcggt gctgctctgg atcctgtcca gcatcctcga ccagatcacc       720
     gccctcggcg tactgcggac cttcctgccg acccactaca gcaccgcctg gctgggactg       780
     ctgtcgacgc cgatccagac cgacgacgtg gtccggggag cgatctcggc gatcagctac       840
     gcgacgctct tctgggggct ggccttctgg cgcttcaccc gtaaggacat cgtgtcctag       900
//

If you have problems or comments...

PBIL Back to PBIL home page