(data stored in ACNUC7421 zone)

EMBL: CP000667.PE258

CP000667.PE258       Location/Qualifiers
FT   CDS_pept        complement(294503..294862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52743"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J3"
FT                   /protein_id="ABP52743.1"
FT                   /translation="MPGSGRYATRGRAGRPRPPRRRPRPNPYRKDVTTMIHRARRLFSS
FT                   QVRAATFARRRWRGLDPEQVYAYLDRVADELERLTREATTARAEGELIRQALRQWQSRH
FT                   AGCQHATTPNSRWHR"
     gtgccgggct ccggccggta cgccacgcgc ggacgtgccg gtcgcccccg cccgcctcgg        60
     cgccgccctc ggcccaaccc ctaccgaaag gacgtgacaa ccatgatcca ccgagcccga       120
     cgcctcttct catcccaggt acgcgccgcg accttcgccc gacgacgttg gcgcggcctg       180
     gaccccgagc aggtgtacgc ctacctcgac cgcgtcgccg acgagctgga acgactcacc       240
     cgggaggcga cgaccgcccg cgccgagggt gagctgatcc ggcaggcgct gcggcagtgg       300
     cagtcccggc acgccggctg ccagcacgcc accaccccga acagccgatg gcaccgctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page