(data stored in ACNUC7421 zone)

EMBL: CP000667.PE261

CP000667.PE261       Location/Qualifiers
FT   CDS_pept        complement(296813..297613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0261"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52746"
FT                   /db_xref="GOA:A4X1J6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J6"
FT                   /protein_id="ABP52746.1"
FT                   /translation="MFSRRTGDTRRPRCRTPPRGGAGAVTYRAGMQASPSDLTGRARLR
FT                   EAALRLFAERGFAATSARAVAAEAGLSPALVMHHFGSKEGLRAAVDEEVLARLGTALRE
FT                   LDPSGTDLMMSLGEVSARMFGADPVLRGYLRRVLQEDSPASAALFGRLLEGARAELERL
FT                   IATESGHTDADLEWAPFQMLCLIVGPLLLEPVMQPNLDRPMFDVQVLARRSVANQRLLR
FT                   LGLFGADPATAGDATDDLRAGAPDSATATRRAQPTVITDNEIPH"
     atgttcagcc gcagaacggg tgacacccgg cgaccccgct gccggacgcc cccgcggggc        60
     ggtgccggtg cggtgacata ccgtgctggc atgcaagcgt cgccgtcgga cctgaccggg       120
     cgggcgcggc tgcgcgaggc ggccctacgc ctgttcgcgg agcgcggctt cgccgccacc       180
     tcggcccgcg cggtggccgc cgaggctggc ctgtcgccgg ccctggtcat gcaccacttc       240
     ggatccaagg aagggctgcg cgccgccgtc gacgaggagg tcctggcccg gctcggcacc       300
     gcactgcggg aactggatcc gagcggcacg gatctgatga tgtcgctggg cgaggtgtcc       360
     gcgcggatgt tcggcgccga cccggtgctg cgcggctatc tgcgccgggt gttgcaggag       420
     gacagcccgg ccagcgccgc gctgttcggc cgccttctgg agggtgcgcg cgccgagttg       480
     gagcggctga tcgccaccga gagcggccac acggacgcgg acctcgagtg ggcgccgttc       540
     cagatgctgt gcctgatcgt cggcccactg ctactggagc cggtcatgca gcccaacctg       600
     gaccgaccca tgttcgatgt gcaggtgctg gcccgccgca gcgtcgccaa ccaacgccta       660
     ctgcggctgg gcctgttcgg tgccgacccg gcaaccgccg gtgacgcgac cgacgacctc       720
     cgggctggtg cgccggactc cgcaacggcc acccggcgcg cccagccaac cgtgatcacg       780
     gataacgaaa taccgcacta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page