(data stored in ACNUC7421 zone)

EMBL: CP000667.PE279

CP000667.PE279       Location/Qualifiers
FT   CDS_pept        320315..321586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0279"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52764"
FT                   /db_xref="GOA:A4X1L4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L4"
FT                   /protein_id="ABP52764.1"
FT                   /translation="MRERLRHAYQSVRSRRRSAGLRAGTPATASPASPRPAPAPPPPPA
FT                   VGTKTSAPLHSSTTSRDDADVPHALRVGAAWSWRLLAIGIVAWALLRVMGQVRIVIIPL
FT                   AIALLLSALLAPAVGWLLRARFPRSLATAVVLVGGLAAVIGTLTLVVNEFIQGLPVLGE
FT                   KSSQGVRQIQNWLRSGPLRLEDEQLDRYINDVEGWLNENIDGLTSGALSTAATVAEVLT
FT                   GTILVLFATFFFLRDGNRIWRFLVRLMPVNARWKVDDAGRASWQTLGAYVRATVLVACI
FT                   DALGIGIFLVIFEIPFALPLAALVFLASFIPIIGATLSGGVAVLVALVDSGPITALIIL
FT                   GVVIGVQQLEGHVLQPLIMGRAVAIHPLAVIVGIAAGVVLAGVTGALIAVPLIAVLNTA
FT                   VRRLAARTVPETPSDAVVVASRAP"
     atgcgtgaac ggcttcgtca cgcgtaccag tcggtgcggt cccggcggag atcggcgggc        60
     ctacgcgccg ggacgcccgc taccgcctcg ccagcttcgc ccaggccggc accagccccg       120
     ccgccacctc cggcggtcgg cacgaagaca tccgcaccgc tgcacagctc gacgaccagc       180
     cgggacgacg cggacgtgcc gcacgcgctc cgtgtcgggg cggcgtggtc ctggcggctg       240
     ctcgcgatcg ggatcgtcgc ctgggccttg ttgcgggtga tgggtcaggt ccggatcgtg       300
     atcatcccgc tggccatcgc gctgttgctg tcggcactgc tggccccagc cgttggctgg       360
     ctgctccggg cccggttccc gcggtcgctg gcgaccgccg tggtgctggt gggcgggttg       420
     gccgcagtga tcggcacgct gaccctggtg gtcaacgagt tcatccaggg tttgccggtg       480
     ctgggcgaga agtcgtccca gggcgtacgc cagatccaga actggctgag atccggcccg       540
     ctgcgcctcg aggacgagca gctggacagg tacatcaacg atgtcgaagg gtggctcaac       600
     gagaacatcg atgggctgac cagcggggcg ctctccaccg cggccaccgt ggccgaggtg       660
     ttgacgggca cgatcctggt gcttttcgcg accttcttct tccttcgtga cggcaaccgg       720
     atctggcgct tcctggtccg gctgatgccg gtcaacgccc gttggaaggt cgacgacgcc       780
     ggtcgggcgt cctggcagac gctcggcgcg tacgttcggg ccaccgtgct ggtggcctgc       840
     atcgacgcgc tcggcatcgg catcttcctg gtgatcttcg aaatcccgtt cgcgcttccg       900
     ctcgccgcgc tggtcttcct cgcctcgttc atcccgatca tcggggcgac cttgtccggc       960
     ggggtcgcgg tgctcgttgc cctggtggac agcggaccga tcaccgcgtt gatcatcctg      1020
     ggcgtggtaa tcggtgtgca gcagcttgag ggccacgtgc tccagccatt gatcatgggg      1080
     cgggcggtgg ccatccaccc gctcgcggtg atcgtcggta tcgccgccgg cgtggtactc      1140
     gccggggtca ccggggcgct gatcgcggtg ccgttgatcg cggtgctcaa cacggcggta      1200
     cgccgtctcg ccgcccgtac cgtcccggag accccatcgg acgctgtcgt cgtcgcgagc      1260
     agggccccct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page