(data stored in ACNUC7421 zone)

EMBL: CP000667.PE286

CP000667.PE286       Location/Qualifiers
FT   CDS_pept        328389..329336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0286"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52771"
FT                   /db_xref="GOA:A4X1M1"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M1"
FT                   /protein_id="ABP52771.1"
FT                   /translation="MLSRRILAGTALAALALTGCSSNNNEDADGGEKLSGEVKVNGSST
FT                   VAPLSEAAATFYREVQSGVNVSVGTSGTGGGFERFCKGETDISDASRPIKDSEIEACEA
FT                   AGIQYKELIVANDALTVVVSKDNDWADCLTVDQLKAIWEPNSQITSWNQVDPSFPDEPL
FT                   KLFGPGTDSGTFDYFTDEINGEEGASRTDYTASENDNVVVQGVAGTKGGLGYFGFTYFE
FT                   ENADKLKALKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYVSDSGVKKEQVADFVTFYI
FT                   ERIDDIVTEAQYVPLTEEQKSTLQAEFDALKAAA"
     gtgctttcgc ggcgcatcct cgccggcacc gcgctcgccg cgctcgcgct taccggctgc        60
     agcagcaaca acaacgaaga cgccgatggt ggcgagaagc tttcgggtga agtcaaggtc       120
     aacggctcca gcacggtcgc gccgctgagt gaggccgctg ccaccttcta ccgcgaggtt       180
     cagagcggcg tcaacgtctc cgtcggcacc tccggcaccg gcggcggctt cgagcggttc       240
     tgcaaggggg agaccgacat ctctgacgcc tcccgtccga tcaaggactc ggagatcgag       300
     gcctgcgagg cggccggcat tcagtacaag gagctgattg tcgccaacga cgccctcacg       360
     gtggtcgtca gcaaggacaa cgactgggcc gactgcctca cggttgacca gctcaaggcg       420
     atctgggagc cgaactccca gatcaccagc tggaaccagg tcgaccccag cttcccggac       480
     gagccgctga agctcttcgg cccgggtacc gactccggca ccttcgacta cttcaccgac       540
     gagatcaacg gtgaggaggg cgccagccgc accgactaca ccgcgtcgga gaacgacaac       600
     gtcgtcgtgc agggcgttgc cggcaccaag ggtggcctgg gctacttcgg cttcacctac       660
     ttcgaggaga acgcggacaa gctcaaggcg ctcaaggttg acggcggctc cggctgcgtc       720
     gagccgagcc tgaagaccgc gcaggagaac acctaccagc cgctgtcgcg gccgctgttc       780
     atctacgtca gcgactccgg tgtcaagaag gagcaggtcg cggacttcgt caccttctac       840
     atcgagcgga tcgacgacat cgtcacggag gcgcagtacg tcccgctcac cgaggagcag       900
     aagagcaccc tccaggctga gttcgacgcc ctgaaggctg cggcctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page