(data stored in ACNUC7421 zone)

EMBL: CP000667.PE287

CP000667.PE287       Location/Qualifiers
FT   CDS_pept        329338..330285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0287"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52772"
FT                   /db_xref="GOA:A4X1M2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M2"
FT                   /protein_id="ABP52772.1"
FT                   /translation="MAISTSNAGSAAGSALRRGRRRPVDSTVKVLLVAAALVSVATTIG
FT                   IVIALVQPTIGFFQQVSIVEFVTGTSWTPTFAQKAYGVLPLVAATLTVTGVALAIAVPL
FT                   GLGSAIYLSEYANPRTRKVLKPIIELLAGVPTVVYGFVALFALNPLLQKWWPTDNGPAF
FT                   QNLLIAGIAMGIMIVPTIASISEDSMAAVPRSLREGAYALASTKMQVSTRVVVPAAMSG
FT                   IVAAVVLGISRAVGETMIVTIAGGLTSDRIVLNPLEGAATMTAFIANISSGDIPVGSLD
FT                   YDSVFAVGALLFLITFALNAVSIRMVRRFREVYE"
     gtggccatca gcacctcgaa cgccggttcc gccgcgggca gtgccctgcg gcggggccgg        60
     cgtcgccccg ttgacagcac cgtcaaggtc ctgctcgtcg ctgccgcgtt ggtttcggtc       120
     gccaccacga tcgggatcgt catcgcgctg gtgcagccaa cgatcgggtt cttccagcag       180
     gtcagcatcg ttgagttcgt caccggcacg agctggacgc cgaccttcgc gcagaaggcc       240
     tacggagtcc tgcccctcgt cgccgccacg ctgacggtga cgggcgtcgc gctggccatc       300
     gccgttccgc tcggcctggg ctcggcgatc tacctctcgg agtacgccaa cccgcgtacc       360
     cgcaaggtgc tcaagccgat catcgaactg ctcgctggcg tgccgacggt cgtgtacggc       420
     ttcgtcgcgc tcttcgcgct caacccgctg ctgcagaagt ggtggccgac cgacaacgga       480
     ccggccttcc agaacctgct catcgcgggt atcgcgatgg gcatcatgat cgtgccgacc       540
     atcgccagca tctccgagga ctcgatggcc gctgttccgc gcagcctgcg cgagggcgcg       600
     tacgcgttgg cctccacgaa gatgcaggtg tccacccggg tggtggtgcc ggcggcgatg       660
     tccggcatcg tcgccgcggt tgttctgggt atctcccgcg cggtggggga aaccatgatc       720
     gttacgatcg cgggtggtct cacctccgac cggattgtcc tcaatccgct ggagggggcg       780
     gcgaccatga ccgccttcat cgccaacatc tcctcgggcg acatcccggt cgggtcgctc       840
     gactacgact cggtcttcgc cgtcggtgcg ctgctgttcc tcatcacctt cgcgctgaac       900
     gcggtgtcga tccggatggt ccgtcgtttc cgggaggtct acgagtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page