(data stored in ACNUC7421 zone)

EMBL: CP000667.PE295

CP000667.PE295       Location/Qualifiers
FT   CDS_pept        337152..337943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52780"
FT                   /db_xref="GOA:A4X1N0"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N0"
FT                   /protein_id="ABP52780.1"
FT                   /translation="MTTEERPYQDERPRPQRGRRVLVVLLVLLLLLVGLLVVADRVAAG
FT                   VAERALTEQVREELATQGVQAGPPEVEIGGFPFVTQVLDGRYERISIGLKEVRGSVQGD
FT                   VLALPTLDIDAYDVTASLDTLRSGRGGVIAGSVTGTGTISYDSLATRLDREGLQLGERD
FT                   GRLAVTAPVDILGQQVPVSGTADITVEQGQVALRFTGLTAEGLPNGSLARMLLSNFAEG
FT                   ISVDVPLPALPFDLTVSEVRPLPEGLQITAEAVEVPINAAS"
     gtgacgaccg aggagcgccc gtaccaggac gaacgccccc ggccgcagcg cgggcggcgc        60
     gtactcgtcg tgctcctggt cctgctcctg ctcctggtcg ggctgctggt ggtggccgac       120
     cgggtggcgg cgggggtggc cgaacgcgca ctgaccgaac aggtccgtga ggaactcgcc       180
     acgcagggcg ttcaggcggg gccgcccgag gtggaaatcg gcggattccc tttcgtcacc       240
     caggtcctcg acggccgcta cgagcgcatc tccatcgggc tcaaggaggt ccggggatcg       300
     gtccagggtg atgtgctggc cctaccgacc ctcgacatcg acgcctacga cgtgaccgcc       360
     tcgctggaca ccctccgctc cggccggggt ggggtgatcg ccggtagcgt cacgggcacc       420
     ggcaccatca gctacgacag cctcgccacc cgactcgacc gggaggggct acagctgggg       480
     gagcgggacg gccgactcgc ggtgaccgcc ccggtggaca tcctcgggca gcaagtgccg       540
     gtcagcggca ccgccgacat cacggtcgag cagggccagg tggcgttgcg gttcaccggc       600
     ctgaccgcgg agggattgcc gaacgggtcg ctggcccgga tgttgctgag caacttcgcg       660
     gagggcatct ccgttgacgt gcccctgccg gcactgccgt tcgacctcac cgtcagtgag       720
     gtccggccgt tgcccgaagg gctccagatc accgcggagg cggttgaggt gccgatcaac       780
     gcggcgagct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page