(data stored in ACNUC7421 zone)

EMBL: CP000667.PE298

CP000667.PE298       Location/Qualifiers
FT   CDS_pept        complement(339696..340091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52783"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N3"
FT                   /protein_id="ABP52783.1"
FT                   /translation="MRNPFRRFRRWRDRPAPSHPTARTDSLIGANVRRPTGTDSEVDRH
FT                   RSYAGNAGGHHRSATHWPLTPEQVRQQQFPQVRRGLDASEVELFLYRVAADLSAVQTEL
FT                   RRTRDENIRIKRALRDWQSRFTPGVRA"
     gtgcgtaacc cgttccgacg attccgtcgc tggcgagacc gccccgcccc gagccacccc        60
     actgctcgca ccgactcgct gatcggtgcg aacgtgcgcc gccccaccgg caccgacagc       120
     gaggtggacc gccaccggtc gtacgccggc aacgcaggcg ggcaccaccg gtcggcgacc       180
     cactggccgt tgacccccga acaggtacgc cagcaacagt tcccgcaggt ccggcgggga       240
     ctcgacgcat ccgaggtgga actcttcctc tatcgggtcg cggcggacct gtccgcggta       300
     cagaccgagc tgaggaggac ccgggacgag aacatccgga tcaagcgggc gctgcgcgac       360
     tggcagtccc ggttcacccc gggcgtacgg gcatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page