(data stored in ACNUC7421 zone)

EMBL: CP000667.PE299

CP000667.PE299       Location/Qualifiers
FT   CDS_pept        340295..340534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0299"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52784"
FT                   /db_xref="GOA:A4X1N4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N4"
FT                   /protein_id="ABP52784.1"
FT                   /translation="MPATPDYIRISDEIIDDIRSGRYEAGDKLPSIAQLCERYHVSPST
FT                   IQLVNVRLEALEVINRHQGKGVFVTDPKTWLRKP"
     atgccagcga caccggacta catccggatc tccgacgaga tcattgatga catcaggtca        60
     ggccgatacg aagcggggga caagctgccc tcgatcgctc agctctgcga gcggtaccac       120
     gtaagcccgt ccacgatcca gctcgtcaac gtacggctgg aggcgctgga ggtgatcaac       180
     cgtcaccagg gcaagggtgt cttcgtgacc gatccgaaga cgtggctccg taagccctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page