(data stored in ACNUC7421 zone)

EMBL: CP000667.PE30

CP000667.PE30        Location/Qualifiers
FT   CDS_pept        complement(37565..38266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0030"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52515"
FT                   /db_xref="GOA:A4X0W5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W5"
FT                   /protein_id="ABP52515.1"
FT                   /translation="MTERFRSAAHCEPFTVRVPNAVGQSRSRTNPPNPVHVHLPHNACS
FT                   VNSILSRYTYSNISLIKYWYDLRVDQSVLNDPRITAVGLLVEAHAGLSARFTAQFEQHG
FT                   LSPVEFEVLTRLVRSPDNRLRMTDLAAQTSLSTSGVTRVVDRMERDGLLTRRACPADRR
FT                   SSFAVATDSGCKRLDAVLPGHLRIIEEWFTGQLDPESLARLLDGLRRVRDAVHPGATAG
FT                   ATDPEPAPDSR"
     gtgacggagc gattccgctc cgcagcgcat tgtgaaccat ttacggtaag agtgcccaac        60
     gcggtgggcc agagccggtc gcgcacgaac ccgccaaacc ctgttcacgt gcaccttccg       120
     cacaatgctt gctcggtaaa cagcatcctg agcagataca cttacagcaa tatctcgttg       180
     atcaaatact ggtacgatct gcgggtggac cagagtgtgc tcaacgaccc ccggatcacc       240
     gccgtcggcc tactcgtcga ggcgcacgcc gggctgtcgg cccggttcac cgcccagttc       300
     gaacagcacg gcctctcccc ggtggagttc gaggtgctca cccggctcgt ccgctcacct       360
     gacaaccggc ttcggatgac cgacctagcc gcacagacct ccctctccac cagcggggtg       420
     acccgcgtgg tcgaccggat ggaacgcgac ggcctcctca cccggcgcgc ctgccccgcc       480
     gaccgacgca gctcgttcgc ggtggccacc gactccggct gcaagcggct cgacgccgta       540
     ctcccaggtc acctacgaat cattgaagag tggttcaccg ggcagctcga cccggagtca       600
     ctggcccgac tcctcgatgg gctacgtcgg gtgcgagacg cggtccaccc cggcgctact       660
     gccggcgcca ccgacccaga accagccccg gacagccgct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page