(data stored in ACNUC7421 zone)

EMBL: CP000667.PE300

CP000667.PE300       Location/Qualifiers
FT   CDS_pept        340915..341394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N5"
FT                   /protein_id="ABP52785.1"
FT                   /translation="MPATGHRWKKEGGGYCSPMSFEPLSTMESALWGLLGSFIVEALEL
FT                   GAALRRAKTLPWNRPDEPGLPAYLASVVLRLAAGAGLAALIGADGQLASPFAAGLLGIT
FT                   APLLIEKILRQVDMAPAEATTPHHHSTLPLTRSVPPPIAKDQKRAPGEAGSSDVD"
     ttgccagcca ccggccaccg gtggaagaag gaagggggcg gctattgttc gcctatgtcg        60
     ttcgagcccc tttccactat ggagtcagcc ctctgggggc tgctaggtag ctttattgtg       120
     gaagcactcg aacttggcgc tgcgctgcgc cgcgcgaaaa ccctgccatg gaaccgcccc       180
     gatgagccgg gactccccgc atacctggcc tcagtcgtgc tccggctcgc cgctggcgca       240
     gggctcgccg ccctcatcgg agccgacggg cagctagcca gccctttcgc cgccgggctc       300
     ctcggcatca ccgcaccact attgatcgag aaaattctgc gccaggttga catggcgcca       360
     gccgaagcca ccacaccgca ccaccactcg acactacccc tcacccgatc cgtaccaccc       420
     ccgatagcaa aggaccagaa gcgggccccg ggagaagcgg gctcttccga tgtcgactga       480
//

If you have problems or comments...

PBIL Back to PBIL home page