(data stored in ACNUC7421 zone)

EMBL: CP000667.PE301

CP000667.PE301       Location/Qualifiers
FT   CDS_pept        341384..342175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0301"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52786"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N6"
FT                   /protein_id="ABP52786.1"
FT                   /translation="MSTDSFRRQLVLALGRSTPAFHSPRAARPGRLRHLIDALSRRTPA
FT                   FASQQTVDLSSADLHQDDSRTADLRKSDLAGVELNNRDLRETDLAGVNLARANFAGVDL
FT                   TGANLAGVDLRGADLTDVDLTGANLAGVDLRGADLTDVNLTGALLIGADLTGVDLAGVN
FT                   LAGVDLRGVNLTGVDLTSADLREANLDRANLTGVNLREANLYGAVLTSTTLAGARWDWA
FT                   TIWPPDRAAEIWFRSAEWPDQPGVYVVLPDAGGRIRPSVVV"
     atgtcgactg actccttccg ccgccaactt gtgctcgcgc tcggtcggtc cacccccgct        60
     tttcactcac cacgagcagc ccgacctggc cgtttaagac acctcattga tgccctgagc       120
     cgacgtaccc cagccttcgc cagccaacag accgtagatc tgtccagcgc tgatctccac       180
     caggacgact ctcgcaccgc cgacctccgc aagtccgacc tggctggcgt cgagctcaac       240
     aacagggatc ttcgcgagac tgatctcgcc ggtgtcaacc tcgcccgcgc taatttcgct       300
     ggcgttgacc tcaccggtgc gaaccttgcc ggtgtcgacc tccgcggcgc ggacctcacc       360
     gacgtcgacc tcacaggcgc gaaccttgcc ggtgtcgacc tccgcggcgc ggacctcacc       420
     gacgtcaacc tcactggcgc gctgctcatc ggtgccgacc tcaccggtgt tgaccttgcc       480
     ggcgtcaacc tggccggtgt tgaccttcgc ggagtcaatc tcaccggcgt cgacctcacc       540
     agcgccgatc ttcgtgaggc caacctcgat cgcgccaacc tcaccggcgt caacctccgc       600
     gaggccaacc tctacggtgc cgttctcacc agcaccacac tcgcgggggc acggtgggat       660
     tgggccacta tctggccacc cgaccgggca gcggagatct ggttccggtc ggcggaatgg       720
     ccggatcaac cgggcgttta cgtcgtgcta ccagacgctg gcggccggat tcgcccatcc       780
     gttgtcgtgt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page