(data stored in ACNUC7421 zone)

EMBL: CP000667.PE306

CP000667.PE306       Location/Qualifiers
FT   CDS_pept        360124..360624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0306"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52791"
FT                   /db_xref="GOA:A4X1P1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P1"
FT                   /protein_id="ABP52791.1"
FT                   /translation="MSEAKGPIVVCVSPDMAVRERVLRRLDGVGPVLSCADLAELRVML
FT                   FPEPPSGQDRGAGPPETPVSYGELVVDPPGHLVTWRGRPLALTRTERRLLTRLVTPPVR
FT                   LWSYERLFAAVWGGAYLGDTAILHSAIKRLRRKLRLLSGGPRVLTVRGVGYRLVLGSDD
FT                   SGG"
     gtgtctgagg cgaaaggtcc gatcgtggtc tgtgtgagcc ccgacatggc cgtgcgcgag        60
     cgtgtgctgc gtcggctcga cggagtgggg ccggtgctga gttgtgctga tcttgcggag       120
     ctgcgggtga tgctctttcc cgagcctcct tccgggcagg accggggcgc cggcccaccg       180
     gagaccccgg tcagctatgg cgagttggtg gttgacccgc cgggacatct ggtcacctgg       240
     cgaggccgcc cgctggcgct gacccggacc gaacggaggc tgttgacccg gttggtgacc       300
     ccgccggtcc ggctctggag ctacgagcga ctcttcgccg cggtctgggg cggcgcctac       360
     ctcggcgaca ccgcgatcct gcactcggcg atcaagcggc tccggcgcaa actgcgcctg       420
     ctctccggtg gcccacgggt gctgacggtg cgcggggtcg gctaccggct tgtcctgggc       480
     tccgacgact cgggcgggtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page