(data stored in ACNUC7421 zone)

EMBL: CP000667.PE31

CP000667.PE31        Location/Qualifiers
FT   CDS_pept        38287..39765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52516"
FT                   /db_xref="GOA:A4X0W6"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W6"
FT                   /protein_id="ABP52516.1"
FT                   /translation="MGRDVTRGAFSREDRVRYRRKVRRCLDVFALMLDDFGFDADRPMT
FT                   GLEIELNLVDSAAEPAMRNEEILADIADPLFQTELGQFNLELNAAPRLIEGTGFTGYEQ
FT                   DLRGSLARADEWAARSDAKILLVGILPTLTEGHLVVDNLSANERYRALNDQIVGARGED
FT                   IELDIRGVERLQTHTDSIAPESACTSLQFHLQVSPDSFADYWNASQAIAAAQVATGANS
FT                   PYLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   PLLPICEEEDPVEVLHAGGVPKLGELRLHNGTVYRWNRPVYDITEGRPHLRVENRVLPA
FT                   GPTVIDMLANAAFYFGSARGLAEADRPTWSQLPFSSAEENFHSAARRGMDAVVYWPRLG
FT                   EVPVAELVLDVLLPQAATGLDRFGVAPGERDRLLGVIEQRCRTRRNGAVWQAETVWAAE
FT                   RHRKLDRPAALHHMVQRYAELQRSNEPVHTWPVE"
     atgggcaggg atgtcacgcg gggcgccttc tcccgggagg atcgggtccg ctaccgacgc        60
     aaggtgcgtc gttgcctgga cgtcttcgcc ttgatgttgg acgacttcgg gttcgacgcc       120
     gaccggccga tgaccggctt ggagatcgag ctgaacctgg tcgactccgc cgccgaaccg       180
     gcgatgcgta acgaggagat tctcgccgac atcgccgacc cgctcttcca gaccgagctg       240
     gggcagttca atctcgagct gaacgccgcg ccccggctga tcgagggtac cgggttcacc       300
     ggctacgaac aggaccttcg cggcagtctc gcccgcgccg acgagtgggc tgccaggtcc       360
     gacgcgaaga ttctcctggt gggaatcctg cccacactga ccgaggggca cctggttgtc       420
     gacaaccttt ccgctaacga gcgctatcgg gccctcaacg accagatcgt cggagcgcgt       480
     ggcgaggaca tcgagctcga catccgcggg gtcgagcggt tgcagaccca caccgactcg       540
     atcgcccccg agtcggcctg caccagtctg cagttccacc tccaggtctc gccggacagc       600
     ttcgccgact actggaacgc ctcgcaggcg atcgccgccg cccaggtggc aaccggggcc       660
     aactccccct acctgtatgg ccgacaactc tgggcggaga cccggatcgc gttgttccaa       720
     caagcgaccg acaccaggcc agacgagttg aaggcgcagg gcgtccgccc tcgggtctgg       780
     ttcggtgagc ggtggattac ctcaattttt gaccttttcg aggagaacgt ccgctatttt       840
     ccgccgctgc tgccgatctg tgaggaggag gacccggtgg aggtgctgca cgccgggggt       900
     gtgccgaagc tcggcgaact gcgcctgcac aacggaaccg tctaccgttg gaaccggccg       960
     gtctacgaca tcaccgaggg gcgcccgcac ctacgggtgg aaaaccgggt cctgccggcc      1020
     ggcccgacgg tgatcgacat gctggccaac gctgccttct acttcggatc ggcgcgaggg      1080
     ctggcggagg cagaccgtcc gacctggagt cagttgccct tcagctcagc ggaggaaaac      1140
     ttccattccg ccgcccgccg aggcatggac gcggtggtgt actggcctcg gctcggtgag      1200
     gtgccggtcg ccgagctggt cctcgacgtc ctgctgccgc aggcggcgac cgggctggac      1260
     cggttcggcg tggcgcccgg tgagcgagac cggctgctcg gcgtcatcga gcagcgctgc      1320
     cggacccggc gcaacggcgc ggtatggcag gcggaaacgg tgtgggcggc tgagcggcac      1380
     cggaagctcg accgcccggc ggcgctgcac cacatggtcc agcggtacgc cgaactccag      1440
     cgcagcaacg agccggtgca cacctggccg gtcgagtag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page