(data stored in ACNUC7421 zone)

EMBL: CP000667.PE314

CP000667.PE314       Location/Qualifiers
FT   CDS_pept        366300..367142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0314"
FT                   /product="3-keto-5-aminohexanoate cleavage enzyme"
FT                   /note="PFAM: protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52799"
FT                   /db_xref="GOA:A4X1P9"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P9"
FT                   /protein_id="ABP52799.1"
FT                   /translation="MTTGTLITVAPTGAESAKAEVPALPVTLDELLLTAKECEALGASV
FT                   VHVHVRDGEAQPTLDQGRLRETVAALRESTDLVVQLSSGGAVSDPEADRLAVLDAAPDM
FT                   ASCTMGTVNFGADVFLNRWEFIVELHTRMQERGIVPEYEIFDLGHLTALQRLLGTYGLP
FT                   AGGHVHVDFVMGVPGGMPGTPAALVAAEQMLRDLPAGTTFSATGVGRSTIPVLLASLSA
FT                   GGHLRVGMEDTVTYAKGQPVESNMQLVARAVAFAQLAQRLPLTTTEARELLGLPALRR"
     atgacgacag ggacgttgat cacggttgcc ccgaccgggg cggagtcggc caaggccgag        60
     gtgccggcgc tgccggtcac cctcgatgag ctgctgctga ccgcgaagga gtgcgaggcc       120
     ttgggtgcct ccgtggtcca cgtacacgtc cgggacggcg aggcacagcc gaccctcgac       180
     caggggcggc tgcgcgagac cgtcgcggcg cttcgcgaga gcaccgatct ggtcgtgcag       240
     ctctcctcgg gtggcgcggt gagcgacccg gaggccgacc ggctcgccgt gctcgacgcc       300
     gcccccgaca tggcctcctg cacgatgggc acggtcaact tcggtgccga cgtttttctc       360
     aaccggtggg agttcatcgt cgagctgcac acccggatgc aggagcgggg catcgtcccg       420
     gagtacgaga tcttcgacct ggggcacctc accgccctgc aacgcctgct cggcacgtac       480
     ggcctgcccg ccggcgggca cgtgcacgtc gacttcgtca tgggcgtgcc cggcggaatg       540
     cccggcaccc cagcggccct ggtcgccgcc gagcagatgc tgcgggatct gccggccggc       600
     accacgttct cggcgaccgg cgtcggtcgt agcacgatcc cggtcctgct ggcctcgctc       660
     tcggcgggcg gacacctccg ggtgggcatg gaggacacgg tgacctacgc caagggtcag       720
     ccggtcgagt ccaacatgca gctcgtggcc cgcgcggtcg ccttcgccca actcgctcag       780
     cgccttccgc tcaccaccac cgaggcccgt gaactgctcg gcctgcccgc cctccgtcgg       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page