(data stored in ACNUC7421 zone)

EMBL: CP000667.PE317

CP000667.PE317       Location/Qualifiers
FT   CDS_pept        368998..369576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52802"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q2"
FT                   /protein_id="ABP52802.1"
FT                   /translation="MTSQPKTSRIPAPLYAAAGAGDLAYQQLRKLPAVVSELRDRVAAD
FT                   LSTVNGAELRQKATETLRTATVTAENLRRRAATDLDLSRLRETATRNAAVVVASAQAAQ
FT                   ERAATTYGALVGHGERVVGAGVLEAADTVNTDMETTEKAPAPTPAQVAEAAEAKPAAVT
FT                   KRATKATGKPATSSTKSPRATKRTPPAGD"
     atgactagtc agccgaaaac cagtcgtatc cccgccccgc tctacgccgc cgccggtgcc        60
     ggcgatctgg cgtaccagca gctgcgcaag ctccccgcgg ttgtgagtga gttgcgcgac       120
     cgggtcgctg ccgacctcag cacggtaaac ggggccgagc tgcgccagaa ggccaccgag       180
     acgttgcgta cggcgaccgt caccgctgag aacctgcgcc ggcgggccgc caccgacctc       240
     gacctcagcc ggcttcggga gaccgccacc cgcaacgcgg ccgttgtggt cgccagtgcc       300
     caggccgcac aggagcgggc agccaccacc tacggcgcgc tcgtcggtca cggggagcgg       360
     gtcgtcggcg ctggagtact cgaggccgcc gacacggtga acaccgacat ggagacgacc       420
     gaaaaggctc cggctcccac cccggcgcag gtcgccgagg cggccgaggc caagccggcc       480
     gccgtcacga agcgtgccac caaggccact ggcaagccgg ccacctcgtc gacgaagtca       540
     ccgcgcgcga cgaagcggac gccgccggcc ggcgactga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page