(data stored in ACNUC7421 zone)

EMBL: CP000667.PE318

CP000667.PE318       Location/Qualifiers
FT   CDS_pept        369655..369981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52803"
FT                   /db_xref="GOA:A4X1Q3"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q3"
FT                   /protein_id="ABP52803.1"
FT                   /translation="MLAGMAIAAPFAFEVRYVIELILLVFALIVQGVALVHVITQRSDA
FT                   FAAVGTLPKGAWAAILAVCLVLTLLGFGPISLFGLVGIAAGLIYLLDVRTGLRDLRDGR
FT                   GTSW"
     atgcttgccg gcatggccat cgccgcgccg ttcgcttttg aggtccgcta cgttatagag        60
     ctgatcctgc tcgtcttcgc gctcatcgtg cagggagtcg ccctggtcca cgtcatcacc       120
     cagcggtccg acgcgttcgc cgcggtcggc accctgccga agggtgcctg ggcggcgatc       180
     ctcgccgtct gtctggtgct caccctgctc ggcttcggcc cgatcagcct ctttggactg       240
     gtcggaatcg ccgctgggct gatctatctg cttgacgtcc ggacgggtct gcgggacctc       300
     cgggatggcc gggggacctc ctggtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page