(data stored in ACNUC7421 zone)

EMBL: CP000667.PE32

CP000667.PE32        Location/Qualifiers
FT   CDS_pept        complement(39799..41100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52517"
FT                   /db_xref="GOA:A4X0W7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W7"
FT                   /protein_id="ABP52517.1"
FT                   /translation="MARRGWAISIMTALGTAAGAGAAALGFGYGLGIINWAPPPDESVA
FT                   VTAWTASLIWATWIAATSTVAGAVCAQHLRRRGAVEHQQAGSDGTISITDATLASPSGP
FT                   DAAAGTTRETAERSRAEPSEPDGALGKLALVGAAGFGALITVLLTAVPARVAVVPGVAA
FT                   PRDVAAGYAALGVLVGLAMAGWALHSRAAATNVMATVGWLWLLAVVAVVDGVVAGRGLR
FT                   TAQLGIWQLSAGGNELWLRDWFYWPGALLSLGSALLIGILVARGTARRPDQLVGATASG
FT                   AAGPLLVAVAYLLAVPELADLAPGQASAHLIAPYAVIIGFGGSALVAALGQRADRRTRT
FT                   ASPRPVEPAAESPQSAESPTDPQSDGSTVATPTTRGRTRGSGSRRPRTAKSEATTAVPA
FT                   QRTVDDAAAEDAGPGSQEPKETDSRRPRSARRTS"
     atggcgagac gcggctgggc aatatcgatc atgaccgcgc ttggcaccgc cgccggggcc        60
     ggcgccgccg cgctgggctt cggctacggc ctgggcatca tcaactgggc cccaccgccc       120
     gatgagagtg tcgccgtcac cgcctggaca gccagcctga tctgggcaac gtggatcgcc       180
     gccacttcta ctgtggctgg tgccgtttgc gcccaacacc tccgtcgtcg tggcgctgtg       240
     gaacaccagc aggccggcag cgacggcaca atttctataa cggacgcgac actcgccagc       300
     ccgagtggcc cggacgccgc cgcagggacc acccgggaga cggcagagcg gagccgggcc       360
     gagccgagtg aacccgatgg tgcgctcggt aagctggcgc tcgtcggagc cgctggattc       420
     ggcgctctga tcacggtgct gttgaccgcc gtaccggctc gggtggccgt ggtacccggt       480
     gtcgccgcgc cccgcgacgt cgccgctgga tatgccgccc tgggcgtcct ggtcggattg       540
     gccatggccg ggtgggctct acactcccgc gccgccgcca ccaacgtgat ggcgaccgtc       600
     ggctggctgt ggctactcgc cgtggtggct gttgtggacg gcgtcgtcgc ggggcgggga       660
     ctccgtaccg cccagctcgg catttggcag ctcagtgccg gcgggaacga gctgtggctc       720
     cgcgactggt tctactggcc gggcgcgctg ctgtcactcg gctccgcgct tctcatcggc       780
     atactggtcg cccggggcac ggccagacgt cccgaccagc tggtgggtgc caccgcctcc       840
     ggcgcagccg gcccgctcct cgtcgcggtc gcctacctgc tcgccgtgcc ggaactggcc       900
     gacctcgctc ccggccaggc gtcggcgcac ctcatcgccc cgtacgcggt catcatcggc       960
     tttggcggct cggcgctggt cgccgcgctc ggccaacggg ccgaccgccg gacgcggaca      1020
     gcttcgcccc gaccggtgga gcccgcggcc gaatcgcccc agtcggcaga gtccccgacc      1080
     gacccgcagt cggacggttc gaccgtcgcg acgcccacca ctcggggccg gacgcgcggg      1140
     tcaggcagcc gacggccccg aaccgcgaag tcggaggcca ccaccgcggt gccggcacag      1200
     cgcactgtgg acgatgcagc agcggaggac gccggccccg ggtcacagga gccgaaggag      1260
     acggactcac gtcggccccg atccgcacgc cgcaccagct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page