(data stored in ACNUC7421 zone)

EMBL: CP000667.PE320

CP000667.PE320       Location/Qualifiers
FT   CDS_pept        complement(371005..372090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0320"
FT                   /product="Polymorphic membrane protein, Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein, Chlamydia"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52805"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q5"
FT                   /protein_id="ABP52805.1"
FT                   /translation="MPCDADALIAAITLANARDGAVLDLARDCTYLLTADIDGNGLPVI
FT                   TAPITLNGNKNTTIERAANADEFRILTVDTGGNLTLDHLTITGGQTTSAGGGILVNPGG
FT                   TLTTNRSTVTRNIADSNGGGIVNNGTTRIISSTISHNTADGPGGGIYSLGVIDVKKSHV
FT                   NANTTTTAGAGVMSFGTARIEHSTVTANHAQGTIGGLFISGTGTVTDSKFSKNTALEAA
FT                   GVVMNFDTQLTLKAVTIIENIATQGRAGGLATSDNSSVVVEGGAITNNAATTDGGGIYN
FT                   FADLVLRDTRINGNQADQGAGIYNEETVILFDTKVVKNVAITDGGGIVNDGGTVELNTA
FT                   TGTIVIKNRPNNCVDVPGCAG"
     gtgccctgcg acgccgacgc cctgatcgcc gcgatcaccc tcgccaacgc ccgcgacggt        60
     gcggtgctcg acctcgccag ggactgcacc tacctgctca ccgccgacat cgacggcaac       120
     ggcctccccg tcatcaccgc gccgatcacc ctcaacggca acaaaaacac caccatcgaa       180
     cgcgccgcca acgccgacga attccggatc ctcaccgtcg acactggcgg caatctcacc       240
     ctcgaccacc tcactatcac cggtggccag accaccagcg ccggcggagg aatcctcgtg       300
     aaccccggtg gaacgctcac cacgaaccgg agcaccgtca cccgcaacat cgccgatagc       360
     aacggcggcg gcatcgtcaa caacggcacc acccgaatca taagctccac catcagccac       420
     aacaccgctg acggccccgg cgggggcatc tacagccttg gcgtaatcga cgtcaaaaag       480
     tcccacgtga acgccaatac caccaccacc gcaggggctg gggtgatgag cttcggcacc       540
     gcccgaatcg agcacagcac cgtcaccgcc aaccacgctc aaggaaccat cggcggcctc       600
     ttcatcagcg gcaccggcac tgtcacggac agcaaatttt cgaaaaacac cgccctcgaa       660
     gctgccggcg tggtcatgaa ttttgacacg caactcacac tcaaagccgt caccattatc       720
     gaaaacatcg ccacccaagg cagggcgggc ggcctagcga cgagcgataa ctcctctgtt       780
     gtcgtcgaag gcggtgccat cacgaacaat gccgccacca ccgacggcgg cggcatctac       840
     aactttgcag acctggtatt gcgagacacc aggatcaatg gcaaccaggc cgatcaaggt       900
     gccggcattt acaatgagga aacagtcatc cttttcgaca cgaaggtggt caagaacgtc       960
     gccatcaccg acggcggggg tatcgtcaac gacggcggaa cggtcgagtt gaacaccgcc      1020
     accggcacca tcgtgatcaa gaaccgaccc aacaactgcg tcgacgttcc cggctgcgcc      1080
     ggttga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page