(data stored in ACNUC7421 zone)

EMBL: CP000667.PE327

CP000667.PE327       Location/Qualifiers
FT   CDS_pept        complement(379049..379810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0327"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52812"
FT                   /db_xref="GOA:A4X1R2"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R2"
FT                   /protein_id="ABP52812.1"
FT                   /translation="MNKLHGTKDFWIGALRVEGPAFAAAIAEAPADTPVLSCPGWTVTD
FT                   LTRHLASVYRWVHGNVSTNTVTPPSLHSELVEPNPGETDLQLWQQAYDELMVRFDALDP
FT                   EAPAWNWAPQPKKAGFWPRRIAHETALHRWDAQLSIGAGDPIETKLAADGVSEVLDTCL
FT                   PAGRRPDHGQWHGVVHLSASDAGQEWFLRLRGDGVALLDTDTIFDDHDHHARVQVVGTA
FT                   SDLLLALWGRVSFDTLAVTGERALLAGLRTG"
     atgaacaaac tgcacggcac gaaggacttc tggatcgggg cgctgcgggt ggaggggccg        60
     gccttcgccg cggcgatcgc cgaagcgccc gccgacaccc cggtgctctc ctgtcccggc       120
     tggacggtga ccgacctgac ccggcacctg gcgagcgtct accgctgggt gcacgggaac       180
     gtgtcgacga ataccgtcac cccgccgtcc cttcactccg agcttgtgga gcccaatcca       240
     ggcgagaccg acctccagct gtggcagcag gcgtacgacg agctgatggt gcgtttcgac       300
     gcgctggatc cggaggcacc ggcgtggaac tgggcgccgc agccgaagaa ggccggcttc       360
     tggcctcgcc ggatcgcaca cgagacggcg ctgcaccgct gggacgccca gctctccatc       420
     ggcgcgggcg acccgatcga gacgaagctg gcagccgacg gggtgagcga ggtgctcgac       480
     acctgcctgc cggccggacg acgtccggat catggccagt ggcacggagt ggtacacctg       540
     tcggcctccg atgccgggca ggagtggttc ctgcggttgc gcggtgacgg ggttgccctg       600
     ctggacaccg acaccatctt cgacgaccat gatcatcatg ctcgggtcca ggtcgtcggc       660
     accgccagcg atctgctgct cgcgctctgg ggacgcgtca gcttcgacac cctggcggtg       720
     acgggcgagc gcgccctcct ggctggcctc cggaccggct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page