(data stored in ACNUC7421 zone)

EMBL: CP000667.PE329

CP000667.PE329       Location/Qualifiers
FT   CDS_pept        complement(380982..381788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52814"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R4"
FT                   /protein_id="ABP52814.1"
FT                   /translation="MSRVTAVPARRPLGVATRGTTNPNRLRRVDNWMAVTCGDALRAAA
FT                   DPLVVDLGYGATGVTAVELRSRLAHAVRPDVRVVGLEIDPVRVAAAQPVADPPRLTFAR
FT                   GGFELAGLRPALVRAFNVLRQYDEGEVAGAWATMTGALAPGGLLVEGTCDELGRLGGWV
FT                   LIDEDGPRTLTLGARLATMDHPARLAERLPKALIHRNVEGEPIHALLQALEGAWRAAAP
FT                   YAPFGPRHRWLRTVTAVRDEGWPLAYQPRRWRQGLVTVDWAAVAPR"
     ttgagccggg tgacggcggt gccggcacga cgcccgctcg gcgtcgcgac gcgcgggacg        60
     acgaacccca accggctgcg ccgggtggac aactggatgg ccgtgacctg cggggatgcc       120
     ttgcgtgcgg cagcggatcc gctcgtcgtg gacctgggct acggcgccac cggggtcacc       180
     gccgtcgagt tgcgctcccg tttggcacac gcggtccgcc ccgacgtacg cgtggtcggg       240
     ctggagatcg acccggtccg cgtcgccgcc gcacagccgg tcgccgaccc accccggctc       300
     accttcgccc ggggcggctt cgagctggcc ggcctccgcc ccgccctggt tcgtgccttc       360
     aacgtgctac gccagtacga cgaaggcgag gtggcgggcg cctgggcgac gatgaccggc       420
     gcgctcgctc cgggtggcct gctggtcgag gggacctgcg acgagttggg gcgactcggc       480
     gggtgggtgc tgatcgacga ggacggcccc cgcacgctga ccctgggcgc acggctggcc       540
     accatggacc accccgcccg gctcgccgaa cggctcccca aggccctgat ccaccgcaac       600
     gtcgaggggg agccaatcca tgccctactc caggccctgg agggtgcctg gcgggcggcg       660
     gccccctacg cccccttcgg cccccgccac cgctggctgc gtacggtgac cgccgtccgc       720
     gacgagggct ggccgctggc gtaccaaccc cgccgctggc gccagggcct ggtcaccgtc       780
     gactgggcgg cggtggctcc ccgctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page