(data stored in ACNUC7421 zone)

EMBL: CP000667.PE341

CP000667.PE341       Location/Qualifiers
FT   CDS_pept        complement(393139..393753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0341"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52826"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S6"
FT                   /protein_id="ABP52826.1"
FT                   /translation="MPRKSSTVGDVNFDAYARTGVDLINVRLDDLDALRSLFPDDVSWM
FT                   RDEVSERDLTIFRRAQKRLRDVFEYGTSGRDVQAVAELNVLLEAYPVQPRISGHDSSDW
FT                   HMHVTSRGASVSAEYLAGAVWGLSVWLCEYGSARFGVCADERCGNVYLDTSSNCCRRFC
FT                   SERCATRSHVAAHRARKRAAIRDRVAVAAQPTGADNLTVVS"
     atgccccgga agtcgtctac cgtgggtgac gtgaacttcg acgcgtacgc ccggaccgga        60
     gttgatctga tcaatgtccg gctggacgac ctcgacgccc tccgttcgct ctttcccgac       120
     gacgtttcgt ggatgcggga cgaagtgtcg gagcgagatc tcacgatctt tcgacgggcg       180
     cagaagcgac ttcgcgatgt cttcgagtac ggcacgtccg ggcgagacgt ccaagcggtc       240
     gccgagctga atgtgctgtt ggaagcgtac ccggtgcagc cgcgcatctc cgggcacgac       300
     tccagtgact ggcacatgca cgtcaccagc cgcggcgcct cggtgagcgc ggagtacctg       360
     gccggcgcgg tctggggact gtcggtgtgg ctctgtgaat acggcagcgc ccggttcggg       420
     gtctgtgcgg acgagcggtg cggcaacgtc tacctggaca cctcgtcgaa ctgctgccga       480
     cggttctgct cggagcgctg cgccacccgc tctcacgtgg cggcgcaccg ggcccgcaag       540
     cgggccgcga tccgcgaccg ggtcgcggtg gcggcgcagc ccaccggggc cgacaacctg       600
     accgtggtca gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page