(data stored in ACNUC7421 zone)

EMBL: CP000667.PE343

CP000667.PE343       Location/Qualifiers
FT   CDS_pept        395085..395294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0343"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52828"
FT                   /db_xref="GOA:A4X1S8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S8"
FT                   /protein_id="ABP52828.1"
FT                   /translation="MAGSRSDGQLSEVRFLTVAEVATVMRVSKMTVYRLVHGGELGAVR
FT                   VGRSFRVPEHSVHEYLRGAFQETA"
     atggccgggt cgcggtccga cggtcagctg tcggaggtca ggttcctcac cgtcgccgag        60
     gtggcgacgg tcatgcgggt gtcgaagatg acggtctacc gcctggtgca cggcggcgag       120
     ctcggcgcgg tccgggtcgg ccggtcgttt cgcgtccccg agcactcggt gcacgagtac       180
     ctacgcggtg cctttcaaga aaccgcctga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page