(data stored in ACNUC7421 zone)

EMBL: CP000667.PE348

CP000667.PE348       Location/Qualifiers
FT   CDS_pept        complement(399039..399911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0348"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52833"
FT                   /db_xref="GOA:A4X1T3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T3"
FT                   /protein_id="ABP52833.1"
FT                   /translation="MASRKVPVNTDTRSHISGGSSAGDAPAPPPDRAAAAFFDVDNTMM
FT                   QGASIYWFARGLAARNYVTTSDLLRFAWQQLRFRVLATEHVGDMSQIKEAALAFVEGWQ
FT                   VNDVERLAEEIFDELMAPRIWAGARQLAQGHLDAGQRVWLVSAAPVEIGRVIAARLGLT
FT                   GAIGTVAEVVNGAYTGRLVGDLMHGPAKAEAVTRLAAAEGLDLSRCTAYSDSSNDLPML
FT                   AAAGRGVAVNPDAALAREARRRGWEVRDFRTGRRAVKIAVPSTAAVGLVAGAVTAGLAR
FT                   HRRRSSLRM"
     gtggccagcc gaaaggtgcc ggtcaacacc gacacccgca gtcacatctc cggaggcagc        60
     tcggccggcg acgcaccggc cccgccacca gatcgggccg cggccgcctt cttcgacgtg       120
     gacaacacca tgatgcaggg agcatcgatc tactggttcg cccgcggact cgccgcgcgc       180
     aactacgtca ccaccagcga cctccttcga ttcgcctggc aacagctgcg gttccgggtg       240
     ctcgccaccg agcatgtcgg cgacatgtcg cagatcaagg aggccgcgct cgcgttcgtc       300
     gagggctggc aggtgaacga cgtggagcgc ctcgccgagg agatcttcga cgagctgatg       360
     gcgccccgga tctgggccgg agcccggcaa ctcgcccagg gacacctcga cgccgggcaa       420
     cgggtctggc tggtcagcgc cgccccggtc gagatcggcc gggtgatcgc cgcccggctg       480
     gggctcaccg gtgccatcgg aacggtggcc gaggtggtca acggcgcgta caccggacgg       540
     ctggtcggtg acctgatgca cgggcccgcg aaggcggagg cggtgacccg actcgccgcg       600
     gcggaagggc tggacctgtc ccgctgcacc gcctacagcg actcctccaa cgacctgccg       660
     atgctcgccg cggccggccg cggggtcgcc gtcaacccgg acgccgcgct ggcgcgggag       720
     gctcgccgac gcggatggga ggtacgggac ttccgtaccg ggcgtcgggc cgtgaagatc       780
     gccgtcccgt caaccgccgc cgtcggactg gtcgccggag cggtcaccgc ggggctggcg       840
     cggcaccgcc gccgctcgtc cctccggatg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page