(data stored in ACNUC7421 zone)

EMBL: CP000667.PE349

CP000667.PE349       Location/Qualifiers
FT   CDS_pept        complement(400074..400958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52834"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T4"
FT                   /protein_id="ABP52834.1"
FT                   /translation="MNSDLFFSRRRAERFAQLLDEANGGRRHHVRSRVDEKLTELVAVG
FT                   QQLGDATPTVEVSTEFRTGLRAMLLATAEREGLGRPTPAATTDRTEHRPASSRSFLLPA
FT                   VTARRARARGAILIGIATGAVAVSGISAASENAVPGDALYGMKRSTERAQLVLTGSDHS
FT                   RGQLFLDFARTRLSEAAQLRGDRIGYSGVLDDMDADTRHGVRLLTTAAVQGSDLTALDV
FT                   VNTFVAAQRTAVSGLLDSGNRADRDRTQRSLTLLDDAHLRSDALRAAIVCGLPAPSGSD
FT                   ALGPTPTSCPTNR"
     gtgaacagcg acctcttctt ctcccgtcgg cgcgccgagc gcttcgcgca acttctcgac        60
     gaagcgaacg gcggccgacg acaccacgtc cgatcccggg tcgacgaaaa gctcacggaa       120
     ctcgtcgcag tcgggcagca gctcggtgac gccaccccga cggtcgaggt cagtaccgag       180
     ttccggaccg gcctacgggc gatgctgctg gccaccgccg aacgcgaggg cctcggccgg       240
     cccaccccgg cggccaccac cgaccggacg gaacaccgac cggcatcgag ccgctccttc       300
     ctcctccccg ccgtcaccgc gcggcgggcc cgggcccgcg gggcgatcct gatcggcatc       360
     gcgaccggtg ccgtcgccgt ctccggcatc tccgcagcca gtgagaacgc ggtaccgggc       420
     gacgccctgt acgggatgaa gcgttcgacc gaacgcgcgc agctcgtgtt gaccggctcg       480
     gatcacagtc gtgggcagct cttcctggac ttcgcgcgga cccgcctgag cgaggccgcc       540
     cagctacgcg gcgaccggat cggctacagc ggagtcctgg acgacatgga cgccgacacc       600
     cgccacggcg tacgcctgct caccaccgcc gcggtgcagg gctccgacct gacggcgctc       660
     gacgtggtca acaccttcgt cgccgcgcaa cgtaccgcgg tcagtgggct cctggacagc       720
     gggaaccgtg ccgaccgcga ccgcacccaa cgttccctca cgctcctcga cgatgcccat       780
     ctgcgctcgg acgcgctgcg cgccgccatc gtctgtggcc tgcccgcgcc gagcggcagc       840
     gacgcactcg gtcccactcc gacgagctgc cccaccaacc gctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page