(data stored in ACNUC7421 zone)

EMBL: CP000667.PE350

CP000667.PE350       Location/Qualifiers
FT   CDS_pept        complement(401222..402157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0350"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52835"
FT                   /db_xref="GOA:A4X1T5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T5"
FT                   /protein_id="ABP52835.1"
FT                   /translation="MTTFGYAQRPIGLGDPPPRSTTNERLTPRGPRDDGRLAARSDNGL
FT                   RSRPHPNEAPARSGTPGANAKPVGARVASPARPAMPVQGRRSADPPATADSAATDTAVL
FT                   PALPASTPATGFPSRPDPSDPATEIWALVERAQAGEAEAFGLIYDRYVDTVFRFVYFRV
FT                   GNRQLAEDLTSDTFLRALKRIGSFTWQGRDLGAWLVTIARNLVADHFKSGRYRLEVTTG
FT                   DVLDAEREDRGPEGSPEAAVVEHITNVTLLGAVKQLNPEQQECIVLRFLQGFSVAETAR
FT                   AMGKNEGAIKALQYRAVRALARLLPDGFRT"
     atgacgacct tcggctacgc gcagcggccg atcggcctgg gcgacccgcc tccccgatcc        60
     acgacgaatg aacggttgac accccgcggg ccccgggatg acggccggct cgccgcccgg       120
     agcgacaacg ggctacgcag ccgtccacat cccaacgagg ccccggcccg gagcggaaca       180
     ccgggcgcga acgccaagcc ggtcggagcc cgggtcgcct cgccagcccg gcccgctatg       240
     cccgtacagg gccgccggag cgccgaccca cccgccaccg ccgactccgc cgccaccgac       300
     acggcggtac tgcccgcgtt gccggcgagc acacccgcca ccggcttccc gagccgtccc       360
     gacccgtccg acccggcaac cgagatctgg gcgttggtcg agcgagcgca ggccggggag       420
     gccgaggcct tcggcctgat ctacgaccgg tacgtggaca ccgtcttccg gttcgtctac       480
     ttccgagtgg gcaaccgcca actggcagag gacctcacct ccgacacctt cctccgagcg       540
     ctgaagcgaa tcggtagctt cacctggcag ggccgggacc tcggggcctg gctggtgacg       600
     atcgcccgca acctggtcgc ggaccacttc aaatccggcc gctaccggct cgaggtaacc       660
     actggcgacg tcctcgacgc cgaacgcgaa gaccgggggc cggaaggcag cccggaggcg       720
     gccgtggtcg agcacatcac caatgtcacc ctgctcggtg cggtcaaaca gctcaacccg       780
     gagcagcagg agtgcatcgt gctccgcttc ctccaaggct tctcggtggc ggagacggcg       840
     cgggccatgg gcaagaacga gggcgcgatc aaggccttgc agtaccgggc ggtgcgggcc       900
     ctcgcccggc tgctcccgga cggcttccgg acataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page