(data stored in ACNUC7421 zone)

EMBL: CP000667.PE355

CP000667.PE355       Location/Qualifiers
FT   CDS_pept        406383..407153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0355"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52840"
FT                   /db_xref="GOA:A4X1U0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U0"
FT                   /protein_id="ABP52840.1"
FT                   /translation="MSPHRPPGEPERPVAVPALPDLPEATVARLPEYLRALHNLAENGH
FT                   ETVSSEWLATAAGVNSAKLRKDLSHLGSYGTRGVGYDVALLIDQIEYVLGLTQRRSVAL
FT                   VGVGNLGHALAGYDGFATRGFRIAALFDADPVRVGEEINGLVVRHVDELSRVAIEESIA
FT                   IGVIATPAAAAQRVADRLVAGGVTSILNFAPCVLTVPDGVDVRKVDLAVELQILSFHEH
FT                   RKASLTALPAAGAATLTPLPGDLAATDPQEAIGT"
     atgagtccgc accgtccgcc cggcgagccc gaacgccctg tcgccgtgcc ggcgttgccg        60
     gacctgccag aggcgaccgt cgcccgactt cccgagtatc tccgtgccct gcacaacctg       120
     gccgaaaacg gtcacgagac ggtgtccagc gagtggttgg ccacggccgc aggagtcaac       180
     tccgccaagc tccgcaagga tctgtcacac ctcggttcct acggcacccg gggtgtcggt       240
     tacgacgtag ccctgttgat cgatcagatc gagtacgtgt tggggctcac ccagcggcgg       300
     tcggttgccc tggttggggt gggtaatctc ggtcacgccc tcgctggcta tgacggcttc       360
     gccacccgtg gcttccgcat cgccgcgctc ttcgacgccg accccgttcg ggtcggtgag       420
     gagatcaacg gtctggtcgt ccggcacgtg gacgagctgt cccgggtcgc catcgaggag       480
     tcgatcgcga tcggcgtgat cgccaccccg gccgccgccg cgcagcgggt cgccgaccgg       540
     ctggtcgccg gcggagtaac cagcatcctg aacttcgcgc cctgcgtgct gaccgtgccg       600
     gacggggttg acgtacgcaa ggtcgacctc gccgtcgagc tgcagatcct gtccttccac       660
     gagcaccgta aggcgtccct gaccgcactc cccgccgccg gcgctgccac cctcacccca       720
     ttgccgggtg acctcgccgc caccgacccc caggaggcga tcggcacgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page